Bcl2 Recombinant monoclonal antibody

Bcl2 Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, FC (Intra), ELISA
Cat No. 82469-6-RR
Clone No.240571H5

Host / Isotype

Rabbit / IgG

Reactivity

mouse and More (1)

Applications

WB, IHC, IF-P, FC (Intra), ELISA

Bcl-2, 240571H5, B cell leukemia/lymphoma 2, Bcl 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse kidney tissue, mouse brain tissue, mouse spleen tissue, mouse heart tissue
Positive IHC detected inmouse spleen tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse spleen tissue, mouse thymus tissue, human colon cancer tissue
Positive FC (Intra) detected inNIH/3T3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)-PIF-P : 1:500-1:2000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 2 publications below

Product Information

82469-6-RR targets Bcl2 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag24260

Product name: Recombinant mouse Bcl2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-236 aa of NM-009741

Sequence: MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK

Predict reactive species
Full Name B-cell leukemia/lymphoma 2
Calculated Molecular Weight 26 kDa
Observed Molecular Weight26 kDa
GenBank Accession NumberNM-009741
Gene Symbol Bcl2
Gene ID (NCBI) 12043
RRIDAB_3670523
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP10417
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Bcl2 is a member of the B cell lymphoma 2 protein family. Members of this family regulate cell death in multiple cell types and can have either proapoptotic or antiapoptotic activities. The protein encoded by this gene inhibits mitochondrial-mediated apoptosis. This protein is an integral outer mitochondrial membrane protein that functions as part of signaling pathway that controls mitochondrial permeability in response to apoptotic stimuli. This protein may also play a role in neuron cell survival and autophagy. Abnormal expression and chromosomal translocations of this gene are associated with cancer progression in numerous tissues.

Protocols

Product Specific Protocols
FC protocol for Bcl2 antibody 82469-6-RRDownload protocol
IF protocol for Bcl2 antibody 82469-6-RRDownload protocol
IHC protocol for Bcl2 antibody 82469-6-RRDownload protocol
WB protocol for Bcl2 antibody 82469-6-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

BMC Vet Res

Cecropin AD ameliorates pneumonia and intestinal injury in mice with mycoplasma pneumoniae by mediating gut microbiota

Authors - Bowen Li
mouseWB

ACS Nano

A Hybrid Manganese Nanoparticle Simultaneously Eliminates Cancer Stem Cells and Activates STING Pathway to Potentiate Cancer Immunotherapy

Authors - Yaping Wu
Loading...
||
New chat

Able

正在加载,请稍候...