ESM1 Recombinant monoclonal antibody

ESM1 Uni-rAb® Recombinant Antibody for WB, ELISA
Cat No. 86027-1-RR
Clone No.250287H3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

endocan, endothelial cell molecule 1, Endothelial cell specific molecule 1, Endothelial cell-specific molecule 1, ESM-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHUVEC cells, PC-3 cells, DU 145 cells, A2780 cells, SKOV-3 cells, mouse brain tissue, rat brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

86027-1-RR targets ESM1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3019

Product name: Recombinant human ESM1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 21-184 aa of BC011989

Sequence: SNNYAVDCPQHCDSSECKSSPRCERTVLDDCGCCRVCAAGRGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR

Predict reactive species
Full Name endothelial cell-specific molecule 1
Calculated Molecular Weight 184 aa, 20 kDa
Observed Molecular Weight14 kDa
GenBank Accession NumberBC011989
Gene Symbol ESM1
Gene ID (NCBI) 11082
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NQ30
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ESM1, also known as endocan or endothelial cell-specific molecule 1, is a protein-coding gene that encodes a secreted proteoglycan primarily expressed in endothelial cells of human tissues, including lung, kidney, and vascular systems. The protein consists of a 20 kDa core protein with a dermatan sulfate chain, forming a 50 kDa mature proteoglycan. ESM1 plays a crucial role in endothelial cell proliferation, migration, and angiogenesis (blood vessel formation). It modulates vascular development and maintains endothelial homeostasis. Overexpression of ESM1 is observed in cancers such as gastric, cervical, and lung tumors, where it promotes angiogenesis and tumor progression via pathways like VEGF/ERK signaling. Elevated serum ESM1 levels are associated with poor clinical outcomes in cancer patients.

Protocols

Product Specific Protocols
WB protocol for ESM1 antibody 86027-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...