ESM1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86027-1-RR (same clone as 86027-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86027-1-RR (ESM1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86027-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86027-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86027-1-RR against Human ESM1 were performed. The affinity constant is 66.5 nM.

ESM1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86027-1-PBS

Clone No.250287H3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

endocan, endothelial cell molecule 1, Endothelial cell specific molecule 1, Endothelial cell-specific molecule 1, ESM-1

---

Product Information

86027-1-PBS targets ESM1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3019

  Product name: Recombinant human ESM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 21-184 aa of BC011989

  Sequence: SNNYAVDCPQHCDSSECKSSPRCERTVLDDCGCCRVCAAGRGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR

• Full Name: endothelial cell-specific molecule 1
• Calculated Molecular Weight: 184 aa, 20 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC011989
• Gene Symbol: ESM1
• Gene ID (NCBI): 11082
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NQ30
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ESM1, also known as endocan or endothelial cell-specific molecule 1, is a protein-coding gene that encodes a secreted proteoglycan primarily expressed in endothelial cells of human tissues, including lung, kidney, and vascular systems. The protein consists of a 20 kDa core protein with a dermatan sulfate chain, forming a 50 kDa mature proteoglycan. ESM1 plays a crucial role in endothelial cell proliferation, migration, and angiogenesis (blood vessel formation). It modulates vascular development and maintains endothelial homeostasis. Overexpression of ESM1 is observed in cancers such as gastric, cervical, and lung tumors, where it promotes angiogenesis and tumor progression via pathways like VEGF/ERK signaling. Elevated serum ESM1 levels are associated with poor clinical outcomes in cancer patients.