Tested Applications
| Positive WB detected in | HL-60 cells, HUVEC cells, human placenta tissue |
| Positive IHC detected in | human breast cancer tissue, human renal cell carcinoma tissue, human liver cancer tissue, human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human tonsillitis tissue, human liver cancer tissue, human placenta tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:20000 |
| Immunohistochemistry (IHC) | IHC : 1:10000-1:40000 |
| Immunofluorescence (IF)-P | IF-P : 1:5000-1:20000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67075-1-Ig targets Endoglin/CD105 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat, sheep |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27837 Product name: Recombinant human Endoglin/CD105 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 33-221 aa of BC014271 Sequence: QPVGPERGEVTYTTSQVSKGCVAQAPNAILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTELPSFPKTQILEWAAERGPITSAAELNDPQSILLRLGQAQGSLSFCMLEASQDMGRTLEWRPRTPALVRGCHLEGVAGHKEAHIL Predict reactive species |
| Full Name | endoglin |
| Calculated Molecular Weight | 71 kDa |
| Observed Molecular Weight | 95-100 kDa |
| GenBank Accession Number | BC014271 |
| Gene Symbol | CD105 |
| Gene ID (NCBI) | 2022 |
| RRID | AB_2882383 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P17813 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Endoglin (ENG, CD105) is a homodimeric cell membrane glycoprotein of 180 kDa, composed of disulphide-linked subunits of 95 kDa. Endoglin is a proliferation-associated and hypoxia-inducible protein mainly expressed on vascular endothelial cells. It acts as an accessory receptor for transforming growth factor beta (TFG-β) and is involved in vascular development and remodelling. The important role of Endoglin in angiogenesis and in tumor progression makes it an ideal target for antiangiogenic therapy and a good marker for tumor prognosis. (PMID: 1326540; 14528280; 21737653; 12773481)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Endoglin/CD105 antibody 67075-1-Ig | Download protocol |
| IHC protocol for Endoglin/CD105 antibody 67075-1-Ig | Download protocol |
| WB protocol for Endoglin/CD105 antibody 67075-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Endoglin/CD105 Monoclonal antibody (2D5E8), catalog number 67075-1-Ig, has 9 citations. These appear in journals including Cell Stem Cell, Signal Transduction and Targeted Therapy, J Nanobiotechnology, Stem Cell Research & Therapy, Frontiers in Bioengineering and Biotechnology, Biology (Basel), Placenta, Cell and Tissue Research, and Disease Markers. Research fields span obesity/adipogenesis, osteoarthritis cartilage repair, diabetic retinopathy, glioma therapy, intervertebral disc degeneration, mesenchymal stem cell biology, placental pathology, venous malformations, and aortic aneurysm.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Annexin A1 binds PDZ and LIM domain 7 to inhibit adipogenesis and prevent obesity | ||
Cell Stem Cell Preservation of chondrocyte microspheroids by local sustained hydrogen supply improves osteoarthritic cartilage repair. | ||
J Nanobiotechnology Microglia-specific interleukin-4 delivery by engineered extracellular vesicles restores inner blood-retinal barrier in diabetic retinopathy via GAS6-MERTK pathway. | ||
Stem Cell Res Ther Glioma-associated mesenchymal stem cells-mediated PD-L1 expression is attenuated by Ad5-Ki67/IL-15 in GBM treatment. | ||
Front Bioeng Biotechnol Quiescence preconditioned nucleus pulposus stem cells alleviate intervertebral disc degeneration by enhancing cell survival via adaptive metabolism pattern in rats | ||
Biology (Basel) Immortalization of Mesenchymal Stem Cell Lines from Sheep Umbilical Cord Tissue |









































