CoraLite® Plus 647-conjugated Endoglin/CD105 Monoclonal antibody

• 

  IF Staining of human tonsillitis using CL647-67075

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CoraLite® Plus 647 Endoglin/CD105 antibody (CL647-67075, Clone: 2D5E8 ) at dilution of 1:200.

• 

  IF Staining of human tonsillitis using CL647-67075

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CoraLite® Plus 647 Endoglin/CD105 antibody (CL647-67075, Clone: 2D5E8 ) at dilution of 1:200.

Endoglin/CD105 Monoclonal Antibody for IF-P

Cat No. CL647-67075

Clone No.2D5E8

Host / Isotype

Mouse / IgG2b

Reactivity

Human

Applications

IF-P

Synonyms

CD105, END, Endoglin, ENG, HHT1, ORW, ORW1, 2D5E8

---

Tested Applications

• Positive IF-P detected in: human tonsillitis tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-67075 targets Endoglin/CD105 in IF-P applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27837

  Product name: Recombinant human Endoglin/CD105 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 33-221 aa of BC014271

  Sequence: QPVGPERGEVTYTTSQVSKGCVAQAPNAILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTELPSFPKTQILEWAAERGPITSAAELNDPQSILLRLGQAQGSLSFCMLEASQDMGRTLEWRPRTPALVRGCHLEGVAGHKEAHIL

• Full Name: endoglin
• Calculated Molecular Weight: 71 kDa
• Observed Molecular Weight: 95-100 kDa
• GenBank Accession Number: BC014271
• Gene Symbol: CD105
• Gene ID (NCBI): 2022
• RRID: AB_2920290
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P17813
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Endoglin (ENG, CD105) is a homodimeric cell membrane glycoprotein of 180 kDa, composed of disulphide-linked subunits of 95 kDa. Endoglin is a proliferation-associated and hypoxia-inducible protein mainly expressed on vascular endothelial cells. It acts as an accessory receptor for transforming growth factor beta (TFG-β) and is involved in vascular development and remodelling. The important role of Endoglin in angiogenesis and in tumor progression makes it an ideal target for antiangiogenic therapy and a good marker for tumor prognosis. (PMID: 1326540; 14528280; 21737653; 12773481)