GYS2 Recombinant monoclonal antibody

GYS2 Uni-rAb® Recombinant Antibody for WB, IHC, ELISA
Cat No. 85122-4-RR
Clone No.242595F10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

242595F10, EC:2.4.1.11, Glycogen synthase 2, glycogen synthase 2 (liver)

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse liver tissue, rat liver tissue
Positive IHC detected inmouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:25000-1:100000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85122-4-RR targets GYS2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag18012

Product name: Recombinant human GYS2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 604-703 aa of BC126310

Sequence: YYQHARHLTLSRAFPDKFHVELTSPPTTEGFKYPRPSSVPPSPSGSQASSPQSSDVEDEVEDERYDEEEEAERDRLNIKSPFSLSHVPHGKKKLHGEYKN

Predict reactive species
Full Name glycogen synthase 2 (liver)
Calculated Molecular Weight 703 aa, 81 kDa
Observed Molecular Weight 81 kDa
GenBank Accession NumberBC126310
Gene Symbol GYS2
Gene ID (NCBI) 2998
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP54840
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GYS2 (Glycogen Synthase 2) is a key enzyme involved in the synthesis of glycogen in the liver. It catalyzes the addition of glucose molecules to the growing glycogen chain, playing a crucial role in maintaining glucose homeostasis. GYS2 is essential for liver glycogen synthesis, which acts as a critical energy reserve for maintaining blood glucose levels, especially during fasting or prolonged exercise. Impairment of GYS2 function can lead to glycogen storage disease type 0 (GSD-0), characterized by hypoglycemia and liver glycogen deficiency. The GYS2 is highest expressed in the liver, and its expression in liver was significantly higher than other tissues. (PMID:39150597; PMID:37574425)

Protocols

Product Specific Protocols
IHC protocol for GYS2 antibody 85122-4-RRDownload protocol
WB protocol for GYS2 antibody 85122-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...