HLTF Recombinant monoclonal antibody

HLTF Uni-rAb® Recombinant Antibody for WB, ELISA
Cat No. 86362-2-RR
Clone No.251000A4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, monkey

Applications

WB, ELISA

DNA-binding protein/plasminogen activator inhibitor 1 regulator, EC:2.3.2.27, Helicase-like transcription factor, HIP116, HIP116A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inU-937 cells, HeLa cells, K-562 cells, HCT 116 cells, COS-7 cells, NIH//3T3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

86362-2-RR targets HLTF in WB, ELISA applications and shows reactivity with human, mouse, monkey samples.

Tested Reactivity human, mouse, monkey
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5596

Product name: Recombinant human HLTF protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-354 aa of BC044659

Sequence: MSWMFKRDPVWKYLQTVQYGVHGNFPRLSYPTFFPRFEFQDVIPPDDFLTSDEEVDSVLFGSLRGHVVGLRYYTGVVNNNEMVALQRDPNNPYDKNAIKVNNVNGNQVGHLKKELAGALAYIMDNKLAQIEGVVPFGANNAFTMPLHMTFWGKEENRKAVSDQLKKHGFKLGPAPKTLGFNLESGWGSGRAGPSYSMPVHAAVQMTTEQLKTEFDKLFEDLKEDDKTHEMEPAEAIETPLLPHQKQALAWMVSRENSKELPPFWEQRNDLYYNTITNFSEKDRPENVHGGILADDMGLGKTLTAIAVILTNFHDGRPLPIERVKKNLLKKEYNVNDDSMKLGGNNTSEKADGLS

Predict reactive species
Full Name helicase-like transcription factor
Calculated Molecular Weight 114 kDa
Observed Molecular Weight 114 kDa
GenBank Accession NumberBC044659
Gene Symbol HLTF
Gene ID (NCBI) 6596
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ14527
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Helicase-like Transcription Factor (HLTF) is a crucial nuclear protein and member of the SWI/SNF family of chromatin-remodeling complexes, playing a dual role in transcription regulation and DNA damage repair. It functions dually as a regulator of gene expression, utilizing its ATP-dependent helicase activity to modify chromatin structure and facilitate transcription, and as a central effector in the DNA damage response pathway. HLTF is particularly crucial for promoting error-free DNA repair at stalled replication forks via a mechanism called template switching, which prevents the accumulation of mutagenic lesions. HLTF can be detected as 114 kDa.

Protocols

Product Specific Protocols
WB protocol for HLTF antibody 86362-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...