• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated HRPT2, CDC73 Monoclonal antibody

HRPT2, CDC73 Monoclonal Antibody for IF/ICC
Cat No. CL594-66490
Clone No.4B4H2

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig

Applications

IF/ICC

CDC73, HRPT2, HRPT2; CDC73, 4B4H2, C1orf28

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66490 targets HRPT2, CDC73 in IF/ICC applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag2959

Product name: Recombinant human HRPT2; CDC73 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 109-409 aa of BC014351

Sequence: WRTRTTILQSTGKNFSKNIFAILQSVKAREEGRAPEQRPAPNAAPVDPTLRTKQPIPAAYNRYDQERFKGKEETEGFKIDTMGTYHGMTLKSVTEGASARKTQTPAAQPVPRPVSQARPPPNQKKGSRTPIIIIPAATTSLITMLNAKDLLQDLKFVPSDEKKKQGCQRENETLIQRRKDQMQPGGTAISVTVPYRVVDQPLKLMPQDWDRVVAVFVQGPAWQFKGWPWLLPDGSPVDIFAKIKAFHLKYDEVRLDPNVQKWDVTVLELSYHKRHLDRPVFLRFWETLDRYMVKHKSHLRF

Predict reactive species
Full Name cell division cycle 73, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae)
Calculated Molecular Weight 531 aa, 61 kDa
Observed Molecular Weight 61 kDa
GenBank Accession NumberBC014351
Gene Symbol HRPT2/CDC73
Gene ID (NCBI) 79577
RRIDAB_2883594
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ6P1J9
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Parafibromin is a product of the hyperparathyroidism-jaw tumor syndrome gene HRPT2/CDC73, a putative tumor suppressor gene recently implicated in the autosomal dominant hyperparathyroidism-jaw tumor familial cancer syndrome, sporadic parathyroid cancer, and a minority of families with isolated hyperparathyroidism (PMID: 15580289). Defects in CDC73 are causes of hyperparathyroidism type 1 (HRPT1) and hyperparathyroidism type 2 (HRPT2) as well as parathyroid carcinoma (PRTC) (PMID: 12434154). Tumor suppressor parafibromin to the transcription elongation and RNA processing pathway as a PAF1 complex- and RNA polymerase II-bound protein (PMID: 15923622). Besides, parafibromin is also involved in post-transcriptional control pathways (PMID: 16116486). Recent report has revealed that pathogenic mutation, such as CDC73 gene mutation, is able to affect histone monoubiquitination (PMID: 22021426).

Protocols

Product Specific Protocols
IF protocol for CL594 HRPT2, CDC73 antibody CL594-66490Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...