CoraLite®594-conjugated HRPT2, CDC73 Monoclonal antibody

• 

  IF Staining of human breast cancer using CL594-66490

  Immunofluorescent analysis of (4% PFA) fixed human breast cancer tissue using CL594-66490 (HRPT2; CDC73 antibody) at dilution of 1:50.

• 

  IF Staining of human breast cancer using CL594-66490

  Immunofluorescent analysis of (4% PFA) fixed human breast cancer tissue using CL594-66490 (HRPT2; CDC73 antibody) at dilution of 1:50.

• 

  IF Staining of MCF-7 using CL594-66490

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using CoraLite®594 HRPT2, CDC73 antibody (CL594-66490, Clone: 4B4H2 ) at dilution of 1:200.

• Featured Product
• KD/KO Validated

HRPT2, CDC73 Monoclonal Antibody for IF/ICC

Cat No. CL594-66490

Clone No.4B4H2

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig

Applications

IF/ICC

Synonyms

CDC73, HRPT2, HRPT2; CDC73, 4B4H2, C1orf28

---

Tested Applications

• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66490 targets HRPT2, CDC73 in IF/ICC applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2959

  Product name: Recombinant human HRPT2; CDC73 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 109-409 aa of BC014351

  Sequence: WRTRTTILQSTGKNFSKNIFAILQSVKAREEGRAPEQRPAPNAAPVDPTLRTKQPIPAAYNRYDQERFKGKEETEGFKIDTMGTYHGMTLKSVTEGASARKTQTPAAQPVPRPVSQARPPPNQKKGSRTPIIIIPAATTSLITMLNAKDLLQDLKFVPSDEKKKQGCQRENETLIQRRKDQMQPGGTAISVTVPYRVVDQPLKLMPQDWDRVVAVFVQGPAWQFKGWPWLLPDGSPVDIFAKIKAFHLKYDEVRLDPNVQKWDVTVLELSYHKRHLDRPVFLRFWETLDRYMVKHKSHLRF

• Full Name: cell division cycle 73, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae)
• Calculated Molecular Weight: 531 aa, 61 kDa
• Observed Molecular Weight: 61 kDa
• GenBank Accession Number: BC014351
• Gene Symbol: HRPT2/CDC73
• Gene ID (NCBI): 79577
• RRID: AB_2883594
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q6P1J9
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.