Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

IDH2 Monoclonal antibody

IDH2 Monoclonal Antibody for WB, FC (Intra), ELISA

Cat No. 66918-1-Ig
Clone No. 1F10A10
Publications (2)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human and More (2)

Applications

WB, FC (Intra), ELISA

1F10A10, EC:1.1.1.42, ICD M, ICD-M, IDH 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for IDH2 in ?

Tested Applications

Positive WB detected inJurkat cells, HEK-293 cells, HepG2 cells, SH-SY5Y cells, K-562 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66918-1-Ig targets IDH2 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8950

Product name: Recombinant human IDH2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 104-452 aa of BC009244

Sequence: TQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFKMVFTPKDGSGVKEWEVYNFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ

Predict reactive species
Full Name isocitrate dehydrogenase 2 (NADP+), mitochondrial
Calculated Molecular Weight 452 aa, 51 kDa
Observed Molecular Weight 41-47 kDa
GenBank Accession NumberBC009244
Gene Symbol IDH2
Gene ID (NCBI) 3418
RRIDAB_2882245
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP48735
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IDH2, also named as IDP and ICD-M, belongs to the isocitrate and isopropylmalate dehydrogenases family. It plays a role in intermediary metabolism and energy production. IDH2 is a mitochondrial NADP-dependent isocitrate dehydrogenase that catalyzes oxidative decarboxylation of isocitrate to alpha-ketoglutarate, producing NADPH. It may tightly associate or interact with the pyruvate dehydrogenase complex. IDH2 contains an N-terminal mitochondrial addressing sequence and hence is imported to the mitochondrial matrix, although localization to nuclei has also been reported. Moreover, IDH2, like ~20% of other mitochondrial enzymes, is acetylated at lysines, which inactivates the enzymatic activity.

Protocols

Product Specific Protocols
WB protocol for IDH2 antibody 66918-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The IDH2 Monoclonal antibody (1F10A10), catalog number 66918-1-Ig, has a total of 2 citations. These appear in Nature Communications and Science Advances. The cited research spans two fields: one study investigates mitochondrial protein hyperacetylation and fatty acid oxidation in heart failure with preserved ejection fraction (HFpEF), while the other examines RIPK3-mediated necroptosis in IDH-mutated acute myeloid leukemia cells. Both citations report use of the antibody by Western blot.

SpeciesApplicationTitle
mouse, ratWB

Nat Commun

Pyruvate metabolism enzyme Dlat induces mitochondria protein hyperacetylation to limit fatty acid oxidation in the HFpEF heart.

Authors - Ying Wang
humanWB

Sci Adv

RIPK3 deficiency blocks R-2-hydroxyglutarate-induced necroptosis in IDH-mutated AML cells

Authors - Shuanghong Zhu
Loading...
||
New chat

Able™

正在加载,请稍候...