Tested Applications
| Positive WB detected in | Jurkat cells |
| Positive IHC detected in | human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human breast cancer tissue |
| Positive IF/ICC detected in | Ramos cells |
| Positive FC (Intra) detected in | Ramos cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66142-1-Ig targets IL-4 in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, pig samples.
| Tested Reactivity | human, pig |
| Cited Reactivity | human, mouse, rat, pig, bovine |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9940 Product name: Recombinant human IL-4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 24-153 aa of BC070123 Sequence: GHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS Predict reactive species |
| Full Name | interleukin 4 |
| Calculated Molecular Weight | 153 aa, 17 kDa |
| Observed Molecular Weight | 18 kDa |
| GenBank Accession Number | BC070123 |
| Gene Symbol | IL-4 |
| Gene ID (NCBI) | 3565 |
| RRID | AB_2881539 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P05112 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
IL4 is a cytokine produced by CD4+ T cells in response to helminthes and other extracellular parasites. It promotes the proliferation and differentiation of antigen presenting cells. IL4 also plays a pivotal role in antibody isotype switching and stimulates the production of IgE. This cytokine has been applied in the treatment of autoimmune disorder like multiple myeloma, cancer, psoriasis, and arthritis. IL4 has also been extensively applied to inhibit detrimental effect of Th1. It may promote the growth of epithelial tumors by mediating increased proliferation and survival.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for IL-4 antibody 66142-1-Ig | Download protocol |
| IF protocol for IL-4 antibody 66142-1-Ig | Download protocol |
| IHC protocol for IL-4 antibody 66142-1-Ig | Download protocol |
| WB protocol for IL-4 antibody 66142-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-IL-4 antibody (Cat# 66142-1-Ig) has accumulated 101 citations published in high-impact journals such as Science Translational Medicine, Advanced Materials, ACS Nano, Advanced Science, Biomaterials, Developmental Cell, Cell Reports, Brain, Behavior, and Immunity, and Journal of Immunology. Key research fields include macrophage and microglia M1/M2 polarization, cancer immunology, neurodegeneration, stroke recovery, wound healing, tissue engineering, allergic dermatitis, pulmonary fibrosis, diabetes, and autoimmune disorders.
| Species | Application | Title |
|---|---|---|
Adv Mater Multifunctional Injectable Hydrogel as a Biomimic Lens: Optical-Mechanical Restoration and Dynamic Postoperative Microenvironment Regulation. | ||
Sci Transl Med Immune checkpoint B7-H3 is a therapeutic vulnerability in prostate cancer harboring PTEN and TP53 deficiencies | ||
J Nanobiotechnology Microglia-specific interleukin-4 delivery by engineered extracellular vesicles restores inner blood-retinal barrier in diabetic retinopathy via GAS6-MERTK pathway. | ||
J Nanobiotechnology A novel multifunctional nanocomposite hydrogel orchestrates the macrophage reprogramming-osteogenesis crosstalk to boost bone defect repair | ||
Adv Sci (Weinh) Nanomedicine Penetrating Blood-Pancreas Barrier for Effective Treatment of Acute Pancreatitis |
