Use Able AI chat for product recommendations

Cytokeratin 10 Polyclonal antibody

Cytokeratin 10 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA

Cat No. 18343-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA

KRT10, CK 10, CK10, CK-10, Cytokeratin-10

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse skin tissue, A431 cells, rat skin tissue
Positive IHC detected inhuman cervical cancer tissue, human breast cancer tissue, human lung cancer tissue, human skin cancer tissue, rat skin tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse skin tissue
Positive IF/ICC detected inA431 cells
Positive FC (Intra) detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:20000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

18343-1-AP targets Cytokeratin 10 in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13136

Product name: Recombinant human KRT10 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 235-584 aa of BC034697

Sequence: RLKYENEVALRQSVEADINGLRRVLDELTLTKADLEMQIESLTEELAYLKKNHEEEMKDLRNVSTGDVNVEMNAAPGVDLTQLLNNMRSQYEQLAEQNRKDAEAWFNEKSKELTTEIDNNIEQISSYKSEITELRRNVQALEIELQSQLALKQSLEASLAETEGRYCVQLSQIQAQISALEEQLQQIRAETECQNTEYQQLLDIKIRLENEIQTYRSLLEGEGSSGGGGRGGGSFGGGYGGGSSGGGSSGGGYGGGHGGSSGGGYGGGSSGGGSSGGGYGGGSSSGGHGGSSSGGYGGGSSGGGGGGYGGGSSGGGSSSGGGYGGGSSSGGHKSSSSGSVGESSSKGPRY

Predict reactive species
Full Name keratin 10
Calculated Molecular Weight 584 aa, 59 kDa
Observed Molecular Weight50-59 kDa
GenBank Accession NumberBC034697
Gene Symbol Cytokeratin 10
Gene ID (NCBI) 3858
RRIDAB_10863654
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP13645
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. As a type I keratin, keratin 10 is a suprabasal marker of differentiation in stratified squamous epithelia.

Protocols

Product Specific Protocols
FC protocol for Cytokeratin 10 antibody 18343-1-APDownload protocol
IF protocol for Cytokeratin 10 antibody 18343-1-APDownload protocol
IHC protocol for Cytokeratin 10 antibody 18343-1-APDownload protocol
WB protocol for Cytokeratin 10 antibody 18343-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanIF

Bioact Mater

Biomimetic gender-specific human skin model based on gonads/epidermis-on-a-chip

Authors - Xiangyi Wu
ratIF

Cell Mol Biol Lett

The role of NPY2R/NFATc1/DYRK1A regulatory axis in sebaceous glands for sebum synthesis

Authors - Tao Yang
mouseIF

Aging Cell

Nociceptive transient receptor potential canonical 7 (TRPC7) mediates aging-associated tumorigenesis induced by ultraviolet B.

Authors - Wen-Li Hsu
mouseIHC

Life Sci

The potential of Diosgenin in treating psoriasis: Studies from HaCaT keratinocytes and imiquimod-induced murine model.

Authors - Shidi Wu
humanIF

mBio

Commensal-Related Changes in the Epidermal Barrier Function Lead to Alterations in the Benzo[a]Pyrene Metabolite Profile and Its Distribution in 3D Skin.

Authors - Lisa Lemoine

Pathol Res Pract

Polygonatum polysaccharides inhibit keratinocyte proliferation and inflammation via JAK2/STAT3 pathway modulation in psoriasis.

Authors - Lanbing Deng

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Joshua (Verified Customer) (07-27-2019)

Cells differentiated at air-liquid interface. Cells fixed in 4% paraformaldehyde and stained at 4C overnight. Bright staining with minimal background.

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Human Keratinocytes
Cytokeratin 10 Antibody Immunofluorescence, validation (1:500 dilution) in Human Keratinocytes (Cat no:18343-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...