CoraLite® Plus 647-conjugated Cytokeratin 10 Polyclonal antibody

• 

  FC experiment of A431 using CL647-18343

  1x10^6 A431 cells were intracellularly stained with 0.8 ug CoraLite® Plus 647-conjugated Cytokeratin 10 Polyclonal antibody (CL647-18343)(red), or 0.8 ug CoraLite® Plus 647-conjugated Rabbit IgG control Rabbit PolyAb (CL647-30000) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

Cytokeratin 10 Polyclonal Antibody for FC (Intra)

Cat No. CL647-18343

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

FC (Intra)

Synonyms

KRT10, CK 10, CK10, CK-10, Cytokeratin-10

---

Tested Applications

• Positive FC (Intra) detected in: A431 cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-18343 targets Cytokeratin 10 in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13136

  Product name: Recombinant human KRT10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 235-584 aa of BC034697

  Sequence: RLKYENEVALRQSVEADINGLRRVLDELTLTKADLEMQIESLTEELAYLKKNHEEEMKDLRNVSTGDVNVEMNAAPGVDLTQLLNNMRSQYEQLAEQNRKDAEAWFNEKSKELTTEIDNNIEQISSYKSEITELRRNVQALEIELQSQLALKQSLEASLAETEGRYCVQLSQIQAQISALEEQLQQIRAETECQNTEYQQLLDIKIRLENEIQTYRSLLEGEGSSGGGGRGGGSFGGGYGGGSSGGGSSGGGYGGGHGGSSGGGYGGGSSGGGSSGGGYGGGSSSGGHGGSSSGGYGGGSSGGGGGGYGGGSSGGGSSSGGGYGGGSSSGGHKSSSSGSVGESSSKGPRY

• Full Name: keratin 10
• Calculated Molecular Weight: 584 aa, 59 kDa
• GenBank Accession Number: BC034697
• Gene Symbol: Cytokeratin 10
• Gene ID (NCBI): 3858
• RRID: AB_2934930
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P13645
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. As a type I keratin, keratin 10 is a suprabasal marker of differentiation in stratified squamous epithelia.