• Featured Product
  • KD/KO Validated

NDRG2 Recombinant monoclonal antibody

NDRG2 Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 83902-7-RR
Clone No.241039E8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), ELISA

241039E8, NDRG family member 2, N-myc downstream-regulated gene 2 protein, Protein NDRG2, Protein Syld709613

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, HepG2 cells, rat brain tissue, mouse heart tissue, rat heart tissue, human heart tissue
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83902-7-RR targets NDRG2 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2629

Product name: Recombinant human NDRG2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-357 aa of BC010458

Sequence: MAELQEVQITEEKPLLPGQTPEAAKTHSVETPYVSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTIIGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGMGYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPGHTMEVSC

Predict reactive species
Full Name NDRG family member 2
Calculated Molecular Weight 371 aa, 39 kDa
Observed Molecular Weight41-45 kDa
GenBank Accession NumberBC010458
Gene Symbol NDRG2
Gene ID (NCBI) 57447
RRIDAB_3671484
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ9UN36
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

N-myc downstream-regulated gene 2 (NDRG2) is a newly identified member of the NDRG family that is highly localized and plays an important role in the regulation of astrocyte function. In astrocytes, NDRG2 affects the regulation of apoptosis, astrogliosis, blood-brain barrier integrity, and glutamate clearance. Several preclinical studies have revealed that NDRG2 is implicated in the pathogenesis of many neurological diseases, such as stroke, neurodegeneration and psychiatric disorders. Recent studies demonstrated that NDRG2 functions as a tumor suppressor and may be a prognostic predictor for many different malignant tumors.

Protocols

Product Specific Protocols
FC protocol for NDRG2 antibody 83902-7-RRDownload protocol
IHC protocol for NDRG2 antibody 83902-7-RRDownload protocol
WB protocol for NDRG2 antibody 83902-7-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...