NOV/CCN3 Recombinant monoclonal antibody

NOV/CCN3 Uni-rAb® Recombinant Antibody for WB, ELISA
Cat No. 85731-1-RR
Clone No.250054B2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

CCN family member 3, Ccn3, Cellular communication network factor 3, Nephroblastoma-overexpressed gene protein homolog, Nov

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA172 cells, HEK-293T cells, mouse brain tissue, HeLa cells, mouse thymus tissue, Caco-2 cells, rat thymus tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85731-1-RR targets NOV/CCN3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2856

Product name: Recombinant Mouse Nov protein (rFc Tag)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 26-354 aa of NM_010930.4

Sequence: SLRCPSRCPPKCPSISPTCAPGVRSVLDGCSCCPVCARQRGESCSEMRPCDQSSGLYCDRSADPNNQTGICMVPEGDNCVFDGVIYRNGEKFEPNCQYFCTCRDGQIGCLPRCQLDVLLPGPDCPAPRKVAVPGECCEKWTCGSDEQGTQGTLGGLALPAYRPEATVGVEVSDSSINCIEQTTEWSACSKSCGMGVSTRVTNRNRQCEMVKQTRLCIVRPCEQEPEEVTDKKGKKCLRTKKSLKAIHLQFENCTSLYTYKPRFCGVCSDGRCCTPHNTKTIQVEFQCLPGEIIKKPVMVIGTCTCYSNCPQNNEAFLQDLELKTSRGEI

Predict reactive species
Full Name nephroblastoma overexpressed gene
Calculated Molecular Weight39 kDa
Observed Molecular Weight 46 kDa
GenBank Accession NumberNM_010930.4
Gene Symbol Nov
Gene ID (NCBI) 18133
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ64299
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CCN family member 3 (CCN3), also known as Nephroblastoma overexpressed (NOV) protein, is a member of the CCN protein family (PMID: 1309586). CCN3 is predominantly expressed in the cytoplasm, nucleus, and extracellular space. As a subset of extracellular matrix proteins, it can directly bind to the integrin receptor family on the cell surface and participate in signal transduction between the cell surface and the extracellular matrix structure (PMID: 37378812). CCN3 exhibits anti-proliferative activity in normal cells and most tumor cells (PMID: 17340618). CCN3 co-localizes with connexin 43 (C×43) in the plasma membrane, and these two proteins physically interact to inhibit cell growth (PMID: 15213231). CCN3 can induce myofibroblast differentiation through the Notch pathway (PMID: 12050162). CCN can promote adhesion of endothelial cells, vascular smooth muscle cells, and fibroblasts through heparan sulfate proteoglycans (HSPG) (PMID: 30158025).

Protocols

Product Specific Protocols
WB protocol for NOV/CCN3 antibody 85731-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...