Tested Applications
| Positive WB detected in | HEK-293 cells, HaCaT cells, pig colon tissue, mouse colon tissue, HUVEC cells, U2OS cells |
| Positive IP detected in | HUVEC cells |
| Positive IHC detected in | mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse colon tissue, rat colon tissue |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)-P | IF-P : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
80545-1-RR targets Occludin in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | mouse, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag26173 Product name: Recombinant human Occludin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 360-522 aa of BC029886 Sequence: VDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEEDWIREYPPITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT Predict reactive species |
| Full Name | occludin |
| Calculated Molecular Weight | 522 aa, 59 kDa |
| Observed Molecular Weight | 59 kDa |
| GenBank Accession Number | BC029886 |
| Gene Symbol | Occludin |
| Gene ID (NCBI) | 4950 |
| RRID | AB_2918901 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q16625 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Occludin is an integral membrane protein located at the tight junction. It is a tetraspanin protein with four transmembrane domains, intracellular N and C termini, and two extracellular loops. Occludin plays a role in the formation and regulation of the tight junction paracellular permeability barrier. Occludin can exist in different isoforms, owing to modifications at the posttranscriptional and posttranslational levels. The monomeric occludin migrates as 53-65 kDa on SDS-PAGE (PMID: 22083955; 19457074).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Occludin antibody 80545-1-RR | Download protocol |
| IHC protocol for Occludin antibody 80545-1-RR | Download protocol |
| IP protocol for Occludin antibody 80545-1-RR | Download protocol |
| WB protocol for Occludin antibody 80545-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Occludin Recombinant monoclonal antibody (8B2), catalog number 80545-1-RR, has 4 citations published in Antioxidants (Basel), Phytotherapy Research, Frontiers in Immunology, and Precision Clinical Medicine. The research fields span CNS demyelination and repair, ferroptosis in ethanol-induced liver injury, intestinal necroptosis and pyroptosis in piglets, and citrullination-related mucosal inflammation in inflammatory bowel disease.
| Species | Application | Title |
|---|---|---|
Antioxidants (Basel) Dynamic Transcriptomic and Cellular Remodeling Underlie Cuprizone-Induced Demyelination and Endogenous Repair in the CNS | ||
Phytother Res Ginsenoside Rg5 Ameliorates Ferroptosis in Ethanol-Induced Acute Liver Injury by Activating FTO-YTHDF2-Nrf2 Signal. | ||
Front Immunol Enterotoxigenic Escherichia coli-induced intestinal epithelial necroptosis drives lamina propria immune cell pyroptosis and mucosal injury in piglets. | ||
Precis Clin Med Citrullination of CAMP exacerbating mucosal inflammation in inflammatory bowel disease. |
Reviews
What customers say
One reviewer (Clara Berdasco) rated this antibody 5 out of 5 stars in March 2023. Used at a 1:200 dilution on mouse gut (duodenum) tissue for immunofluorescence, she reported excellent performance on both epifluorescence and confocal microscopes and stated she would recommend it 100%.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Clara (Verified Customer) (03-10-2023) | The antibody was excellent on the epifluorescence microscope as on the confocal microscope. I recommended 100%
|
