Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

SLC31A1 Recombinant monoclonal antibody

SLC31A1 Uni-rAb® Recombinant Antibody for WB, IHC, ELISA

Cat No. 83844-5-RR
Clone No.240868D10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

COPT1, 240868D10, CTR1, Truncated CTR1 form

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, SW480 cells, HepG2 cells
Positive IHC detected inhuman kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83844-5-RR targets SLC31A1 in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag26601

Product name: Recombinant human SLC31A1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-67 aa of BC013611

Sequence: MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFGFKNVELLFSGLVINTAG

Predict reactive species
Full Name solute carrier family 31 (copper transporters), member 1
Calculated Molecular Weight 21 kDa
Observed Molecular Weight21-23 kDa
GenBank Accession NumberBC013611
Gene Symbol SLC31A1
Gene ID (NCBI) 1317
RRIDAB_3671429
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDO15431
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC31A1, also known as CTR1, COPT1 and solute carrier family 31 member 1, is a high-affinity copper transporter found in the cell membrane of human cells. It plays a crucial role in maintaining copper homeostasis within the body and functions as a homotrimer to influence dietary copper absorption in the cell membrane (PMID: 37853210; 28507097). SLC31A1 has three putative transmembrane domains, with an N-terminus located extracellularly and a C-terminus located intracellularly (PMID: 12827356). SLC31A1 can be detected a a 28 kDa band corresponding to glycosylated hCTR1 monomer, and a 24 kDa band that is unglycosylated hCTR1. In some membrane preparations a C-terminal degradation product of 17 kDa is also seen (PMID: 16135512). Additionally, SLC31A1 may also resolve as a 30 to 35 kDa and a 60 to 70 kDa protein on immunoblots, forming oligomers corresponding to the expected size of a homotrimeric complex (PMID: 12827356).

Protocols

Product Specific Protocols
IHC protocol for SLC31A1 antibody 83844-5-RRDownload protocol
WB protocol for SLC31A1 antibody 83844-5-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle

Cell Rep Med

Nilotinib induces immunogenic cuproptosis to potentiate cancer immunotherapy.

Authors - Lei Yao
humanWB

ACS Pharmacol Transl Sci

Copper Transporter 1‑Mediated Deregulation of Copper Homeostasis Impacts MYC and Oxidative Phosphorylation Pathways and Increases the Sensitivity of Tumor Cells to Complex I Inhibitors.

Authors - Rima Mouawad
  • KO Validated

Life Sci

Nitroxyl relieves acute kidney injury by suppressing SLC31A1-mediated cuproptosis in renal tubular epithelial cells.

Authors - Xiao Fu

Placenta

GYS2 links cuproptosis and M1 macrophage polarization in preeclampsia: a functional and mechanistic analysis.

Authors - Huanping Wang
Loading...
||
New chat

Able

正在加载,请稍候...