Use Able AI chat for product recommendations

TFF2 Recombinant monoclonal antibody

TFF2 Uni-rAb® Recombinant Antibody for WB, FC (Intra), IP, ELISA

Cat No. 83717-4-RR
Clone No.240661G12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), IP, ELISA

SML1, 240661G12, SP, Spasmolysin, Spasmolytic polypeptide

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman urine sample
Positive IP detected inmouse stomach tissue
Positive FC (Intra) detected inPC-3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83717-4-RR targets TFF2 in WB, FC (Intra), IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag4537

Product name: Recombinant human TFF2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-129 aa of BC032820

Sequence: MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY

Predict reactive species
Full Name trefoil factor 2
Calculated Molecular Weight 129 aa, 14 kDa
Observed Molecular Weight 18-20 kDa
GenBank Accession NumberBC032820
Gene Symbol TFF2
Gene ID (NCBI) 7032
RRIDAB_3671319
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ03403
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The trefoil factor family (TFF), comprises of three polypeptides, TFF1, TFF2 and TFF3 (7-12 kDa), secreted to mucosal surfaces by mucus producing cells, prominently in the gastrointestinal tract. TFF2, also known as spasmolytic polypeptide, is a low-molecular weight protein, expressed in mucous neck cells of the fundus and glands at the base of the antrum in normal human stomach. TFF2 could Inhibit gastrointestinal motility and gastric acid secretion. However, recent studies suggest that TFF2 could also play an important role in the immune system. We got a 18-20 kDa band in western botting maybe due to glycosylatation, and mature TFF2 is a 12 kDa protein (PMID: 10716671).

Protocols

Product Specific Protocols
FC protocol for TFF2 antibody 83717-4-RRDownload protocol
IP protocol for TFF2 antibody 83717-4-RRDownload protocol
WB protocol for TFF2 antibody 83717-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...