Tested Applications
| Positive WB detected in | HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, THP-1 cells, K-562 cells |
| Positive IHC detected in | human liver cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:5000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66777-1-Ig targets TOM20 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, monkey, chicken, bovine |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2378 Product name: Recombinant human TOM20 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-145 aa of BC000882 Sequence: MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE Predict reactive species |
| Full Name | translocase of outer mitochondrial membrane 20 homolog (yeast) |
| Calculated Molecular Weight | 145 aa, 16 kDa |
| Observed Molecular Weight | 16 kDa |
| GenBank Accession Number | BC000882 |
| Gene Symbol | TOM20 |
| Gene ID (NCBI) | 9804 |
| RRID | AB_2882123 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q15388 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TOM20, also named as KIAA0016, belongs to the Tom20 family. It is a central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22, TOM20 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the TOM40 translocation pore. TOM20 is characterized as major docking receptors to mediate the recognition by different mechanisms.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for TOM20 antibody 66777-1-Ig | Download protocol |
| IF protocol for TOM20 antibody 66777-1-Ig | Download protocol |
| IHC protocol for TOM20 antibody 66777-1-Ig | Download protocol |
| WB protocol for TOM20 antibody 66777-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
TOM20 Monoclonal antibody (1D6F5), catalog number 66777-1-Ig, has 150 citations appearing in journals including Nature, Science, Autophagy, Nature Communications, Advanced Science, Redox Biology, Cell Death & Disease, EMBO Journal, and Brain. Research fields span mitochondrial biology (mitophagy, fission/fusion), oncology, neurodegeneration (Alzheimer's, Parkinson's), ferroptosis and cuproptosis, inflammation, diabetes, cardiovascular disease, and renal pathology.
| Species | Application | Title |
|---|---|---|
Science Structural insight into the SAM-mediated assembly of the mitochondrial TOM core complex. | ||
Nat Aging Senescent macrophages induce ferroptosis in skeletal muscle and accelerate osteoarthritis-related muscle atrophy | ||
Nat Chem Photocatalytic labelling-enabled subcellular-resolved RNA profiling and synchronous multi-omics investigation. | ||
Bioact Mater Copper doped bioactive glass promotes matrix vesicles-mediated biomineralization via osteoblast mitophagy and mitochondrial dynamics during bone regeneration | ||
J Extracell Vesicles Transfer of inflammatory mitochondria via extracellular vesicles from M1 macrophages induces ferroptosis of pancreatic beta cells in acute pancreatitis |
Reviews
What customers say
Overall, 4 out of 5 reviewers rated this antibody positively (average ~4.2/5). Immunofluorescence performance was consistently praised, with users reporting specific detection in iPSC-derived motor neurons, human bone marrow mesenchymal stem cells, and general imaging experiments at dilutions of 1:200–1:500. One Western Blot user gave a positive rating on T cells, while another reported unsatisfactory WB results in keratinocyte and endothelial cells at 1:1000, noting inferior performance compared to a competitor's product. In summary, the antibody excels in IF applications but may show variable results in WB depending on cell type.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Quanyuan (Verified Customer) (04-06-2026) | This antibody doesn't work in the WB assays (the second band from bottom to the top of the marker is 15kDa, in the attached result), comparing to the Rabbit anti-TOM20 from another company which works very good.
![]() |
Pierre (Verified Customer) (09-26-2025) | Very Good
|
Paula (Verified Customer) (08-06-2024) | Worked well for human bone marrow mesenchymal stem cells. Secondary antibody dilution used 1:400 for 90min room temp.
![]() |
Elena (Verified Customer) (05-06-2024) | Specific detection
|
Boyan (Verified Customer) (02-22-2024) | good for imaging experiments
|



















