Timp-3 Recombinant monoclonal antibody

Timp-3 Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA
Cat No. 83627-1-RR
Clone No.240374D8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), ELISA

TIMP3, 240374D8, HSMRK222, K222, K222TA2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman placenta tissue
Positive FC (Intra) detected inHeLa cells, MDA-MB-231 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83627-1-RR targets Timp-3 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34657

Product name: Recombinant human Timp-3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 168-211 aa of BC014277

Sequence: MLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDP

Predict reactive species
Full Name TIMP metallopeptidase inhibitor 3
Calculated Molecular Weight 24 kDa
Observed Molecular Weight 24-33 kDa
GenBank Accession NumberBC014277
Gene Symbol TIMP3
Gene ID (NCBI) 7078
RRIDAB_3671240
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP35625
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Timp-3 (TIMP metallopeptidase inhibitor 3), also known as SFD. It is expected to be located in extracellular space, and the protein is enriched in the placenta tissue and fat tissue. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix (ECM). Expression of this gene is induced in response to mitogenic stimulation, and this netrin domain-containing protein is localized to the ECM. Mutations in this gene have been associated with the autosomal dominant disorder Sorsby's fundus dystrophy. TIMP-3 is expressed as an unglycosylated 24 kDa and glycosylated 29 kDa protein with inhibitory activity against interstitial collagenase, stromelysin-1, and gelatinases A and B (PMID:11827795).

Protocols

Product Specific Protocols
FC protocol for Timp-3 antibody 83627-1-RRDownload protocol
WB protocol for Timp-3 antibody 83627-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...