• Featured Product
  • KD/KO Validated

CoraLite® Plus 647-conjugated BCL2 Monoclonal antibody

BCL2 Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL647-60178
Clone No.4H8C6

Host / Isotype

Mouse / IgG2b

Reactivity

human, pig

Applications

IF/ICC, FC (Intra)

BCL-2, 4H8C6

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inMCF-7 cells, HeLa cells
Positive FC (Intra) detected inhuman peripheral blood lymphocytes

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-60178 targets BCL2 in IF/ICC, FC (Intra) applications and shows reactivity with human, pig samples.

Tested Reactivity human, pig
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag3508

Product name: Recombinant human BCL2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-239 aa of BC027258

Sequence: MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK

Predict reactive species
Full Name B-cell CLL/lymphoma 2
Calculated Molecular Weight 26 kDa
Observed Molecular Weight 26 kDa
GenBank Accession NumberBC027258
Gene Symbol BCL2
Gene ID (NCBI) 596
RRIDAB_2934981
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP10415
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

1) What is Bcl-2?
Bcl-2 (B-cell lymphoma 2) is an outer mitochondrial membrane protein that via heterodimerization with BAX proteins controls apoptosis. Abnormalities of Bcl-2 activity can lead to cancer, autoimmune diseases, and schizophrenia.
2) FAQs for Bcl-2

A) How to measure Bcl-2 and Bax apoptotic markers by western blotting
Generally, Bcl-2 protein is considered to have anti-apoptotic activity, while Bax has apoptotic activity. Comparing the ratio between Bcl-2 and Bax protein levels in different samples or cells subjected to treatments can reflect the apoptotic state of the cells. Expression of Bax can vary between cell lines and it is important to compare it to Bcl-2 levels.
B) What band size should I expect in western blotting for Bcl-2?
The molecular weight of Bcl-2 is 26 kDa.

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 BCL2 antibody CL647-60178Download protocol
IF protocol for CL Plus 647 BCL2 antibody CL647-60178Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...