Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, HepG2 cells, SH-SY5Y cells, mouse liver tissue, rat liver tissue |
| Positive IP detected in | mouse liver tissue |
| Positive IHC detected in | human breast cancer tissue, mouse brain tissue, mouse brown adipose tissue, rat brown adipose tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10624-2-AP targets FASN in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, monkey, chicken, zebrafish, sheep, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0975 Product name: Recombinant human FASN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 142-439 aa of BC007909 Sequence: QTQLNLRSLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSLAEPRVSVREG Predict reactive species |
| Full Name | fatty acid synthase |
| Calculated Molecular Weight | 272 kDa |
| Observed Molecular Weight | 250-272 kDa |
| GenBank Accession Number | BC007909 |
| Gene Symbol | FASN |
| Gene ID (NCBI) | 2194 |
| RRID | AB_2100801 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P49327 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FASN gene codes for an enzyme essential for de novo fatty acid synthesis and cellular substrate energy metabolism. Active FASN is a homodimer in which each peptide subunit has a molecular weight of 260 kDa. FASN is overexpressed in various types of cancer including glioblastomas and is a potential therapeutic target. Recently FASN has been reported to contribute to the neurogenesis since FASN mutation caused intellectual disability in mice.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for FASN antibody 10624-2-AP | Download protocol |
| IF protocol for FASN antibody 10624-2-AP | Download protocol |
| IHC protocol for FASN antibody 10624-2-AP | Download protocol |
| IP protocol for FASN antibody 10624-2-AP | Download protocol |
| WB protocol for FASN antibody 10624-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The FASN Polyclonal antibody (catalog number 10624-2-AP) has accumulated 446 citations. These appear in high-impact journals including Nature, Science, Cell, Cancer Cell, Cell Metabolism, Nature Communications, Molecular Cancer, Cell Death & Disease, and Acta Pharmacologica Sinica. Research fields span lipid metabolism and de novo lipogenesis, cancer (hepatocellular, breast, colorectal, prostate, and bladder cancers), ferroptosis, nonalcoholic fatty liver disease/steatohepatitis, obesity, diabetes, and immune and metabolic reprogramming. Applications are predominantly Western blot, with IHC, IF, and IP also represented.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Protein C receptor maintains cancer stem cell properties via activating lipid synthesis in nasopharyngeal carcinoma. | ||
Cancer Cell Multiomic integration reveals tumoral heterogeneity of lipid dependence within lethal group 3 medulloblastoma. | ||
Reviews
What customers say
Users report consistent performance of this FASN antibody in Western blot, with clear signals, low background, and bands at the expected molecular weight. One reviewer noted occasional double bands near the correct size. The antibody also performed well in IHC on mouse and rat liver tissues. Recommended dilutions ranged from 1:100 to 1:5000 for WB and 1:200 for IHC. Overall, reviewers praised the clean results and minimal optimization needed, with ratings averaging 4.6 out of 5 across five reviews.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Megha (Verified Customer) (01-26-2026) | This product worked fine in western blot, at the correct molecular weight mark. In some blots, it does produce to lines around the same molecular weight location
|
MALLIKARJUNA (Verified Customer) (11-26-2025) | GOOD FOR WB APPLICATION
|
YINGJIAN (Verified Customer) (08-07-2025) | Clear signal and very low background—saved a lot of optimization time
 |
K (Verified Customer) (12-20-2020) | I got good results with this Ab for WB at (1:1000) and IHC (1:200)
|
Iram (Verified Customer) (09-18-2020) | FASN antibody gives a very clean bands.Excellent antibody
|
