Tested Applications
| Positive WB detected in | mouse cerebellum tissue, Jurkat cells |
| Positive IHC detected in | mouse cerebellum tissue, human cerebellum tissue, human endometrial cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14946-1-AP targets RPS27A in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6750 Product name: Recombinant human RPS27A protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-156 aa of BC001392 Sequence: MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK Predict reactive species |
| Full Name | ribosomal protein S27a |
| Calculated Molecular Weight | 18 kDa |
| Observed Molecular Weight | 9 kDa, 18 kDa |
| GenBank Accession Number | BC001392 |
| Gene Symbol | RPS27A |
| Gene ID (NCBI) | 6233 |
| RRID | AB_2878093 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P62979 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RPS27A, also named as UBA80 and UBCEP1, can be cleaved into two chains Ubiquitin and 40S ribosomal protein S27a. Ubiquitin is a highly conserved 76-amino acid protein that plays a key role in protein degradation. Ubiquitin is synthesized as precursor proteins that consist either of polyubiquitin chains that are cleaved into moieties of the UBB or UBC types, or single ubiquitin moieties fused 5-prime to unrelated carboxyl extension proteins (UBA type) such as UBA52 and UBA80 (RPS27A) [PMID:10772958]
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for RPS27A antibody 14946-1-AP | Download protocol |
| IF protocol for RPS27A antibody 14946-1-AP | Download protocol |
| IHC protocol for RPS27A antibody 14946-1-AP | Download protocol |
| WB protocol for RPS27A antibody 14946-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The RPS27A (Ubiquitin) polyclonal antibody (Cat# 14946-1-AP) has 9 total citations published in journals including Nature Communications, Neuron, Cell Reports, Journal of Pineal Research, Frontiers in Chemistry, Mediators of Inflammation, PLoS One, and bioRxiv. Research fields span ferroptosis, erythroid genome integrity, Alzheimer's disease and circadian biology, stress granule proteomics, radiation-induced tissue damage, and cancer (prostate and cervical). Applications cited include Western blotting and immunofluorescence in human and mouse samples.
| Species | Application | Title |
|---|---|---|
Nat Commun Nuclear and cytoplasmic specific RNA binding proteome enrichment and its changes upon ferroptosis induction | ||
Nat Commun DDX41 resolves G-quadruplexes to maintain erythroid genome integrity and prevent cGAS-mediated cell death | ||
Neuron Reconstructed cell-type-specific rhythms in human brain link Alzheimer's pathology, circadian stress, and ribosomal disruption. | ||
Cell Rep The proteome and transcriptome of stress granules and P bodies during human T lymphocyte activation | ||
J Pineal Res Amelioration of gamma irradiation-induced salivary gland damage in mice using melatonin | ||
Front Chem Integration of RNA-seq and ATAC-seq analyzes the effect of low dose neutron-γ radiation on gene expression of lymphocytes from oilfield logging workers |
