CoraLite® Plus 488-conjugated RPS27A Polyclonal antibody

RPS27A Polyclonal Antibody for IF/ICC
Cat No. CL488-14946

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

CEP80, HUBCEP80, ribosomal protein S27a, RPS27A, UBA80, UBCEP1, UBCEP80, ubiquitin

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-14946 targets RPS27A in IF/ICC applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6750

Product name: Recombinant human RPS27A protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-156 aa of BC001392

Sequence: MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK

Predict reactive species
Full Name ribosomal protein S27a
Calculated Molecular Weight18 kDa
Observed Molecular Weight 9 kDa, 18 kDa
GenBank Accession NumberBC001392
Gene Symbol RPS27A
Gene ID (NCBI) 6233
RRIDAB_3672612
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen Affinity Purified
UNIPROT IDP62979
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

RPS27A, also named as UBA80 and UBCEP1, can be cleaved into two chains Ubiquitin and 40S ribosomal protein S27a. Ubiquitin is a highly conserved 76-amino acid protein that plays a key role in protein degradation. Ubiquitin is synthesized as precursor proteins that consist either of polyubiquitin chains that are cleaved into moieties of the UBB or UBC types, or single ubiquitin moieties fused 5-prime to unrelated carboxyl extension proteins (UBA type) such as UBA52 and UBA80 (RPS27A) [PMID:10772958]

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 RPS27A antibody CL488-14946Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...