Tested Applications
| Positive WB detected in | HEK-293 cells, Jurkat cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human lung cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:5000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15010-1-AP targets SKP2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6826 Product name: Recombinant human SKP2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-344 aa of BC001441 Sequence: MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSR Predict reactive species |
| Full Name | S-phase kinase-associated protein 2 (p45) |
| Calculated Molecular Weight | 48 kDa |
| Observed Molecular Weight | 46-48 kDa |
| GenBank Accession Number | BC001441 |
| Gene Symbol | SKP2 |
| Gene ID (NCBI) | 6502 |
| RRID | AB_2187647 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13309 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SKP2(S-phase kinase-associated protein 2) is also named as FBXL1 and belongs to the F-box family. It regulates cellular proliferation by targeting several cell cycle-regulated proteins for ubiquitination and degradation, including cyclin-dependent kinase inhibitor CDKN1B(PMID:22200179). The acetylation of SKP2 in the nuclear localization signal (NLS) can promote its cytoplasmic retention, and cytoplasmic SKP2 enhances cellular migration through ubiquitination and destruction of CDH. This protein has 3 isoforms produced by alternative splicing (PMID:26497688, PMID:16902410).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SKP2 antibody 15010-1-AP | Download protocol |
| IHC protocol for SKP2 antibody 15010-1-AP | Download protocol |
| IP protocol for SKP2 antibody 15010-1-AP | Download protocol |
| WB protocol for SKP2 antibody 15010-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SKP2 Polyclonal antibody (Cat# 15010-1-AP) has 72 citations. These appear in journals including Cancer Cell, Nature Metabolism, Nature Communications, Journal of Clinical Investigation, Cell Death & Differentiation, Cell Death & Disease, Oncogene, EMBO Journal, JBC, FASEB Journal, and many others. Research fields span oncology (breast, lung, gastric, pancreatic, renal, prostate, liver, and bone cancers), cell cycle regulation, ubiquitin-proteasome signaling, autophagy, ferroptosis, renal fibrosis, diabetic nephropathy, spinal cord injury, and immunology. Applications are predominantly Western blot, with IHC, IF, and CoIP also used.
| Species | Application | Title |
|---|---|---|
Nat Metab Myc-mediated SDHA acetylation triggers epigenetic regulation of gene expression and tumorigenesis. | ||
Nat Commun DNA damage during S-phase mediates the proliferation-quiescence decision in the subsequent G1 via p21 expression. | ||
J Adv Res OTUD7B attenuates renal fibrosis by regulating PRDX1 protein stability.
| ||
Redox Biol Cyclic helix B peptide alleviates proinflammatory cell death and improves functional recovery after traumatic spinal cord injury | ||
Theranostics TFE3, a potential therapeutic target for Spinal Cord Injury via augmenting autophagy flux and alleviating ER stress. |
Reviews
What customers say
Able is busy answering your previous question. Please try again later.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Daniel (Verified Customer) (07-31-2025) | Amazing antibody. Works very well even at 1:10000 with a very strong signal
|
Jonathan (Verified Customer) (01-11-2022) | Good clear signal with no background issues. I'm happy with the blots obtained using this antibody.
|
