CoraLite® Plus 488-conjugated SKP2 Polyclonal antibody

• 

  IF Staining of HepG2 using CL488-15010

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite® Plus 488 SKP2 antibody (CL488-15010) at dilution of 1:200.

• Featured Product
• KD/KO Validated

SKP2 Polyclonal Antibody for IF/ICC

Cat No. CL488-15010

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

F box protein Skp2, F box/LRR repeat protein 1, FBL1, FBXL1, FLB1, p45skp2, SKP2

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-15010 targets SKP2 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6826

  Product name: Recombinant human SKP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-344 aa of BC001441

  Sequence: MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSR

• Full Name: S-phase kinase-associated protein 2 (p45)
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC001441
• Gene Symbol: SKP2
• Gene ID (NCBI): 6502
• RRID: AB_3083967
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13309
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

SKP2(S-phase kinase-associated protein 2) is also named as FBXL1 and belongs to the F-box family. It regulates cellular proliferation by targeting several cell cycle-regulated proteins for ubiquitination and degradation, including cyclin-dependent kinase inhibitor CDKN1B(PMID:22200179). The acetylation of SKP2 in the nuclear localization signal (NLS) can promote its cytoplasmic retention, and cytoplasmic SKP2 enhances cellular migration through ubiquitination and destruction of CDH. This protein has 3 isoforms produced by alternative splicing (PMID:26497688, PMID:16902410).