Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

ATP5F1 Polyclonal antibody

ATP5F1 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 15999-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA

ATP synthase F(0) complex subunit B1, mitochondrial, ATP synthase peripheral stalk-membrane subunit b, ATP synthase proton-transporting mitochondrial F(0) complex subunit B1, ATP synthase subunit b, ATP5F 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse heart tissue, HeLa cells, mouse skeletal muscle tissue, mouse liver tissue
Positive IP detected inHEK-293T cells
Positive IHC detected inhuman liver tissue, human brain tissue, human heart tissue, human kidney tissue, human skin tissue, human testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:100-1:400
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15999-1-AP targets ATP5F1 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8571

Product name: Recombinant human ATP5F1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-256 aa of BC005366

Sequence: MLSRVVLSAAATAAPSLKNAAFLGPGVLQATRTFHTGQPHLVPVPPLPEYGGKVRYGLIPEEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLGVMVYGIKKYGPFVADFADKLNEQKLAQLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCIADLKLLAKKAQAQPVM

Predict reactive species
Full Name ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1
Calculated Molecular Weight 256 aa, 29 kDa
Observed Molecular Weight 25-30 kDa
GenBank Accession NumberBC005366
Gene Symbol ATP5F1
Gene ID (NCBI) 515
RRIDAB_2258817
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP24539
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATP5F1(ATP synthase subunit b) belongs to the eukaryotic ATPase B chain family. The ATP5F1 gene encodes subunit B of the mitochondrial ATP synthase Fo unit, which contains 214-amino acid with a 42-amino acid import signal(PMID:1831354). Mitochondrial membrane ATP synthase(F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain.

Protocols

Product Specific Protocols
FC protocol for ATP5F1 antibody 15999-1-APDownload protocol
IF protocol for ATP5F1 antibody 15999-1-APDownload protocol
IHC protocol for ATP5F1 antibody 15999-1-APDownload protocol
IP protocol for ATP5F1 antibody 15999-1-APDownload protocol
WB protocol for ATP5F1 antibody 15999-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanIF

Adv Mater

Supramolecular Hydrogel with Ultra-Rapid Cell-Mediated Network Adaptation for Enhancing Cellular Metabolic Energetics and Tissue Regeneration

Authors - Zhuo Li
ratWB

Proc Natl Acad Sci U S A

Evaluation of intramitochondrial ATP levels identifies G0/G1 switch gene 2 as a positive regulator of oxidative phosphorylation.

Authors - Hidetaka Kioka
mouseWB,IHC

Part Fibre Toxicol

Transcriptomics of single dose and repeated carbon black and ozone inhalation co-exposure highlight progressive pulmonary mitochondrial dysfunction.

Authors - Quincy A Hathaway
humanWB

Free Radic Biol Med

Mitochondrial and glucose metabolic dysfunctions in granulosa cells induce impaired oocytes of polycystic ovary syndrome through Sirtuin 3.

Authors - Qing Zhang
mouseWB

J Neurosci

A Mutation in Hnrnph1 That Decreases Methamphetamine-Induced Reinforcement, Reward, and Dopamine Release and Increases Synaptosomal hnRNP H and Mitochondrial Proteins.

Authors - Qiu T Ruan
ratWB

Cell Death Dis

Calcium sensing receptor protects high glucose-induced energy metabolism disorder via blocking gp78-ubiquitin proteasome pathway.

Authors - Yuehong Wang

Reviews

    5.0 out of 5
Add a review

2 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


siting (Verified Customer) (07-13-2020)

very good signal

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: mouse heart cells
ATP5F1 Antibody Western Blot, validation (1:1000 dilution) in mouse heart cells (Cat no:15999-1-AP)

Yan (Verified Customer) (01-28-2020)

It worked very well with mouse heart tissue for western blot.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mouse heart tissue extract
Loading...
||
New chat

Able

正在加载,请稍候...