Tested Applications
| Positive WB detected in | Y79 cells, mouse brain tissue, Jurkat cells |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28180-1-AP targets NET1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28142 Product name: Recombinant human NET1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 442-542 aa of BC010285 Sequence: IRAAIAPFQSAGSPPELQGLPELHEECEGNHPSARKLTAQRRASTVSSVTQVEVDENAYRCGSGMQMAEDSKSLKTHQTQPGIRRARDKALSGGKRKETLV Predict reactive species |
| Full Name | neuroepithelial cell transforming 1 |
| Calculated Molecular Weight | 596 aa, 68 kDa |
| Observed Molecular Weight | 68 kDa |
| GenBank Accession Number | BC010285 |
| Gene Symbol | NET1 |
| Gene ID (NCBI) | 10276 |
| RRID | AB_2881082 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q7Z628 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NET1 antibody 28180-1-AP | Download protocol |
| IHC protocol for NET1 antibody 28180-1-AP | Download protocol |
| WB protocol for NET1 antibody 28180-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The NET1 antibody (Cat# 28180-1-AP) has 8 total citations spanning journals including Gastroenterology, Cell Death & Disease, Gastric Cancer, Reproductive Biology and Endocrinology, Scientific Reports, iScience, Frontiers in Cardiovascular Medicine, and Theriogenology. Research fields covered include pancreatic cancer, lung cancer, gastric cancer, oocyte biology, tumor immune regulation, cardiac fibrosis, atherosclerosis, and early embryonic development.
| Species | Application | Title |
|---|---|---|
Gastroenterology Cell-in-Cell-Mediated Entosis Reveals A Progressive Mechanism in Pancreatic Cancer
| ||
Cell Death Dis Cancer-associated fibroblasts promote osimertinib resistance in non-small cell lung cancer cells via METTL1-mediated NET1 m(7)G modification.
| ||
Gastric Cancer LncRNA CTC-497E21.4 promotes the progression of gastric cancer via modulating miR-22/NET1 axis through RhoA signaling pathway. | ||
Reprod Biol Endocrinol NET1 is a critical regulator of spindle assembly and actin dynamics in mouse oocytes
| ||
Sci Rep Multiomics analysis reveals the involvement of NET1 in tumour immune regulation and malignant progression | ||
iScience Neuroepithelial cell-transforming 1 promotes cardiac fibrosis via the Wnt/β-catenin signaling pathway
|
