Tested Applications
| Positive WB detected in | pig colon tissue, human colon tissue, pig stomach tissue, human stomach tissue, rat colon tissue, rat stomach tissue, rabbit stomach tissue, mouse colon tissue |
| Positive IHC detected in | human colon tissue, human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse heart tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:400 |
| Immunofluorescence (IF)-P | IF-P : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
60213-1-Ig targets transgelin/SM22 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0764 Product name: Recombinant human TAGLN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-201 aa of BC004927 Sequence: MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS Predict reactive species |
| Full Name | transgelin |
| Calculated Molecular Weight | 22 kDa |
| Observed Molecular Weight | 18+22 kDa |
| GenBank Accession Number | BC004927 |
| Gene Symbol | transgelin/SM22 |
| Gene ID (NCBI) | 6876 |
| RRID | AB_11043177 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q01995 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The transgelin family is a group of proteins that belong to 22 kDa actin-related corpnin superfamily. Of all three isoforms, transgelin 1 is the best characterized. Transgelin 1, also known as SM22 alpha, is a specific marker for differentiated smooth muscle cells. Transgelin 2, also known as SM22 beta, is expressed by both smooth muscle and non-smooth muscle cells in a temporally and spatially regulated pattern. Trangenlin 3, also known as NP25, is only found in highly differentiated neuronal cells.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for transgelin/SM22 antibody 60213-1-Ig | Download protocol |
| IHC protocol for transgelin/SM22 antibody 60213-1-Ig | Download protocol |
| WB protocol for transgelin/SM22 antibody 60213-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The transgelin/SM22 Monoclonal antibody (Cat# 60213-1-Ig) has 40 citations published in journals including Nature Communications, Circulation Research, Development, FASEB Journal, Journal of the American Heart Association, Cell Signaling, Atherosclerosis, and Frontiers in Cardiovascular Medicine, among others. Research fields span vascular smooth muscle cell phenotypic switching, atherosclerosis, aortic dissection, pulmonary hypertension, vascular remodeling, and cardiovascular disease mechanisms.
| Species | Application | Title |
|---|---|---|
Nat Commun Perivascular adipose single-cell atlas identifies CD55(+) adipose-derived stem cells as vascular remodeling regulators in atherosclerosis. | ||
Nat Commun Improving erectile function in diabetic male mice by rescuing depalmitoylated FBP1 to reduce cavernosal lactate. | ||
Circ Res LncRNA PSR Regulates Vascular Remodeling Through Encoding a Novel Protein Arteridin | ||
J Adv Res Cytoskeletal-related genes function as checkpoints for the maintenance of VSMC contractile phenotype and prevent pathological remodeling in arterial diseases | ||
Cardiovasc Diabetol Non-coding RNA-mediated endothelial-to-mesenchymal transition in human diabetic cardiomyopathy, potential regulation by DNA methylation | ||
Genes Dis Macrophage κ-opioid receptor inhibits hypoxic pulmonary hypertension progression and right heart dysfunction via an SCD1-dependent anti-inflammatory response. |
Reviews
What customers say
The single review for this product rates it 5/5 for immunofluorescence on intervertebral disc cells at a 1:100 dilution. The user noted that no permeabilization was needed and blocking was performed with 5% FBS and 2% BSA. They mentioned some background was observed, but overall the antibody performed well for their application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Ana Luísa (Verified Customer) (07-25-2022) | No permeabilization. Blocking with 5%FBS and 2%BSA. Some background
|
