CoraLite®594-conjugated transgelin/SM22 Monoclonal antibody

• 

  IF Staining of mouse heart using CL594-60213

  Immunofluorescent analysis of (4% PFA) fixed mouse heart tissue using CL594-60213 (transgelin/SM22 antibody) at dilution of 1:100.

• 

  IF Staining of mouse heart using CL594-60213

  Immunofluorescent analysis of (4% PFA) fixed mouse heart tissue using CL594-60213 (transgelin/SM22 antibody) at dilution of 1:100.

transgelin/SM22 Monoclonal Antibody for IF-P

Cat No. CL594-60213

Clone No.2A10C2

Host / Isotype

Mouse / IgG1

Reactivity

human, rat, pig, mouse

Applications

IF-P

Synonyms

22 kDa actin binding protein, DKFZp686P11128, Protein WS3 10, SM22, SM22 alpha, SM22alpha, SMCC, Smooth muscle protein 22 alpha, TAGLN, TAGLN1, transgelin, TRANSGELIN 1, transgelin/SM22, WS3 10

---

Tested Applications

• Positive IF-P detected in: mouse heart tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-60213 targets transgelin/SM22 in IF-P applications and shows reactivity with human, rat, pig, mouse samples.

• Tested Reactivity: human, rat, pig, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0764

  Product name: Recombinant human TAGLN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-201 aa of BC004927

  Sequence: MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS

• Full Name: transgelin
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 18+22 kDa
• GenBank Accession Number: BC004927
• Gene Symbol: transgelin/SM22
• Gene ID (NCBI): 6876
• RRID: AB_2883444
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q01995
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

The transgelin family is a group of proteins that belong to 22 kDa actin-related corpnin superfamily. Of all three isoforms, transgelin 1 is the best characterized. Transgelin 1, also known as SM22 alpha, is a specific marker for differentiated smooth muscle cells. Transgelin 2, also known as SM22 beta, is expressed by both smooth muscle and non-smooth muscle cells in a temporally and spatially regulated pattern. Trangenlin 3, also known as NP25, is only found in highly differentiated neuronal cells.