Tested Applications
| Positive WB detected in | human heart tissue, pig heart tissue, rat heart tissue, rabbit heart tissue |
| Positive IHC detected in | mouse heart tissue, human heart tissue, mouse skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | C2C12 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
60229-1-Ig targets Myosin Light Chain 2/MLC-2V in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.
| Tested Reactivity | human, mouse, rat, pig, rabbit |
| Cited Reactivity | human, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1356 Product name: Recombinant human MYL2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-166 aa of BC015821 Sequence: MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD Predict reactive species |
| Full Name | myosin, light chain 2, regulatory, cardiac, slow |
| Calculated Molecular Weight | 19 kDa |
| Observed Molecular Weight | 18 kDa |
| GenBank Accession Number | BC015821 |
| Gene Symbol | Myosin Light Chain 2 |
| Gene ID (NCBI) | 4633 |
| RRID | AB_2881356 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P10916 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MYL2, also named as MLC-2v and MLC-2, is ventricular/cardiac muscle isoform. Defects in MYL2 are the cause of cardiomyopathy familial hypertrophic type 10 (CMH10). Defects in MYL2 are the cause of cardiomyopathy familial hypertrophic with mid-left ventricular chamber type 2 (MVC2). MYL2 has been widely used as a marker of mature ventricular cardiomyocytes.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Myosin Light Chain 2/MLC-2V antibody 60229-1-Ig | Download protocol |
| IHC protocol for Myosin Light Chain 2/MLC-2V antibody 60229-1-Ig | Download protocol |
| WB protocol for Myosin Light Chain 2/MLC-2V antibody 60229-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Myosin Light Chain 2/MLC-2V Monoclonal antibody (5A1F1), catalog number 60229-1-Ig, has a total of 5 citations. These appear in journals including Med, Stem Cell Reviews and Reports, World Journal of Stem Cells, Stem Cells, and International Journal of Stem Cells. The associated research fields encompass cardiomyocyte differentiation, cardiac repair, stem cell biology, and myogenic signaling pathways, with applications in immunofluorescence and Western blot.
| Species | Application | Title |
|---|---|---|
Med AI-driven therapeutic antisense oligonucleotide for processing-deficient progeroid laminopathies. | ||
Stem Cell Rev Rep MYOCD is Required for Cardiomyocyte-like Cells Induction from Human Urine Cells and Fibroblasts Through Remodeling Chromatin. | ||
World J Stem Cells MiR-21-5p-enriched exosomes from hiPSC-derived cardiomyocytes exhibit superior cardiac repair efficacy compared to hiPSC-derived exosomes in a murine MI model | ||
Stem Cells Nitric Oxide-cGMP-PKG Pathway Acts on Orai1 to Inhibit the Hypertrophy of Human Embryonic Stem Cell-Derived Cardiomyocytes. | ||
Int J Stem Cells Synergistic Effect of Hydrogen and 5-Aza on Myogenic Differentiation through the p38 MAPK Signaling Pathway in Adipose-Derived Mesenchymal Stem Cells |
Reviews
What customers say
The single available review (rated 1/5) reports that this antibody exhibited significant non-specific binding when used on Jurkat cell lysates by Western Blot at a 1:800 dilution. The reviewer noted it bound to many unrelated proteins, making the results difficult to interpret. No other reviews are currently on file for this catalog number.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Irem (Verified Customer) (04-19-2022) | Unfortunately, this antibody unspecifically binds to many proteins in Jurkat cells.
![]() |


















