CoraLite® Plus 488-conjugated Myosin Light Chain 2 Monoclonal antibody

Myosin Light Chain 2 Monoclonal Antibody for IF/ICC
Cat No. CL488-60229
Clone No.5A1F1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

IF/ICC

CMH10, DKFZp779C0562, MLC 2, MLC 2v, MLC2, MLC2v, MYL2, Myosin Light Chain 2, Myosin Light Chain 2/MLC-2V

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inC2C12 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-60229 targets Myosin Light Chain 2 in IF/ICC applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1356

Product name: Recombinant human MYL2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-166 aa of BC015821

Sequence: MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD

Predict reactive species
Full Name myosin, light chain 2, regulatory, cardiac, slow
Calculated Molecular Weight 19 kDa
Observed Molecular Weight 18 kDa
GenBank Accession NumberBC015821
Gene Symbol Myosin Light Chain 2
Gene ID (NCBI) 4633
RRIDAB_2883123
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP10916
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

MYL2, also named as MLC-2v and MLC-2, is ventricular/cardiac muscle isoform. Defects in MYL2 are the cause of cardiomyopathy familial hypertrophic type 10 (CMH10). Defects in MYL2 are the cause of cardiomyopathy familial hypertrophic with mid-left ventricular chamber type 2 (MVC2). MYL2 has been widely used as a marker of mature ventricular cardiomyocytes.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Myosin Light Chain 2 antibody CL488-60229Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...