CoraLite® Plus 488-conjugated Myosin Light Chain 2 Monoclonal antibody

• 

  IF Staining of C2C12 using CL488-60229

  Immunofluorescent analysis of (-20°C Ethanol) fixed C2C12 cells using CoraLite® Plus 488 Myosin Light Chain 2 antibody (CL488-60229, Clone: 5A1F1 ) at dilution of 1:200.

Myosin Light Chain 2 Monoclonal Antibody for IF/ICC

Cat No. CL488-60229

Clone No.5A1F1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

IF/ICC

Synonyms

CMH10, DKFZp779C0562, MLC 2, MLC 2v, MLC2, MLC2v, MYL2, Myosin Light Chain 2, Myosin Light Chain 2/MLC-2V

---

Tested Applications

• Positive IF/ICC detected in: C2C12 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-60229 targets Myosin Light Chain 2 in IF/ICC applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1356

  Product name: Recombinant human MYL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-166 aa of BC015821

  Sequence: MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD

• Full Name: myosin, light chain 2, regulatory, cardiac, slow
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC015821
• Gene Symbol: Myosin Light Chain 2
• Gene ID (NCBI): 4633
• RRID: AB_2883123
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P10916
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

MYL2, also named as MLC-2v and MLC-2, is ventricular/cardiac muscle isoform. Defects in MYL2 are the cause of cardiomyopathy familial hypertrophic type 10 (CMH10). Defects in MYL2 are the cause of cardiomyopathy familial hypertrophic with mid-left ventricular chamber type 2 (MVC2). MYL2 has been widely used as a marker of mature ventricular cardiomyocytes.