Tested Applications
| Positive WB detected in | human spleen tissue, THP-1 cells, HL-60 cells, U-937 cells |
| Positive IHC-Autostainer detected in | human liver tissue, human tonsillitis tissue, human ovary cancer tissue, human appendicitis tissue |
| Positive IHC detected in | human tonsillitis tissue, human breast cancer tissue, human tonsillitis tissue, human liver tissue, human ovary cancer tissue, human lung cancer tissue, human appendicitis tissue, human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human tonsillitis tissue, human appendicitis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC)-AUTOSTAINER | IHC-AUTOSTAINER : 1:7500-1:30000 |
| Immunohistochemistry (IHC) | IHC : 1:10000-1:40000 |
| Immunofluorescence (IF)-P | IF-P : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
60258-1-Ig targets CD11c in WB, IHC, IHC-Autostainer, IF-P, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, rat, pig |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag11350 Product name: Recombinant human CD11c/Integrin alpha X protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 21-352 aa of BC038237 Sequence: NLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLFHASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMA Predict reactive species |
| Full Name | integrin, alpha X (complement component 3 receptor 4 subunit) |
| Calculated Molecular Weight | 1169 aa, 129 kDa |
| Observed Molecular Weight | 145 kDa |
| GenBank Accession Number | BC038237 |
| Gene Symbol | CD11c |
| Gene ID (NCBI) | 3687 |
| ENSEMBL Gene ID | ENSG00000140678 |
| RRID | AB_2881379 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P20702 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Integrins are cell adhesion receptors that are heterodimers composed of non-covalently associated α and β subunits. CD11c/Integrin alpha X is a 145-150 kDa type I transmembrane glycoprotein present on a variety of cells, including monocytes/macrophages, granulocytes, NK cells and dendritic cells. Integrin alpha X/beta 2 acts a receptor for fibrinogen and is important in monocyte adhesion and chemotaxis.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CD11c antibody 60258-1-Ig | Download protocol |
| IHC protocol for CD11c antibody 60258-1-Ig | Download protocol |
| WB protocol for CD11c antibody 60258-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
CD11c Monoclonal antibody (2F1C10), catalog number 60258-1-Ig, has 33 citations across 29 journals including Cell, Science Immunology, Med, Journal of Experimental Medicine, Diabetes, Frontiers in Immunology, and PLoS Pathogens. Research fields span immunology, oncology, infectious disease (HIV, SARS-CoV-2), dermatology, diabetes, vaccine development, ophthalmology, and veterinary science. Cited applications include IF, IHC, and WB, with reactivity in human, rat, and pig.
| Species | Application | Title |
|---|---|---|
Cell Tissue-resident FOLR2+ macrophages associate with CD8+ T cell infiltration in human breast cancer. | ||
Sci Immunol Initiator cell death event induced by SARS-CoV-2 in the human airway epithelium | ||
MedComm (2020) Plasmacytoid and CD141+ Myeloid Dendritic Cells Cooperation with CD8+ T Cells in Lymph Nodes is Associated with HIV Control | ||
Med CCL19+ dendritic cells potentiate clinical benefit of anti-PD-(L)1 immunotherapy in triple-negative breast cancer | ||
J Exp Med AIM2 regulates anti-tumor immunity and is a viable therapeutic target for melanoma. | ||
Reviews
What customers say
The single review for 60258-1-Ig is a 5-star rating from an immunofluorescence application. The user reported the antibody worked well on FFPE prostate tissue at a 1:500 dilution, using Tris-EDTA pH 9.0 for antigen retrieval. Overall, the feedback is positive, indicating reliable performance in IF.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Emma (Verified Customer) (11-29-2021) | Works well by IF on FFPE tissue at 1:500. We used a Tris-EDTA pH 9.0 antigen retrieval.
|
