Use Able AI chat for product recommendations

CD22 Monoclonal antibody

CD22 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 66103-1-Ig
Clone No.7A2F1

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

WB, IHC, IF/ICC, IF-P, ELISA

7A2F1, B cell receptor CD22, B-cell receptor CD22, BL-CAM, B-lymphocyte cell adhesion molecule

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inRamos cells, Raji cells, Daudi cells
Positive IHC detected inhuman tonsillitis tissue, human appendicitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman tonsillitis tissue, Raji cells
Positive IF/ICC detected inRaji cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2500-1:10000
Immunohistochemistry (IHC)IHC : 1:10000-1:40000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66103-1-Ig targets CD22 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17986

Product name: Recombinant human CD22 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 166-515 aa of BC109306

Sequence: ILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPKKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETIGRR

Predict reactive species
Full Name CD22 molecule
Calculated Molecular Weight 847 aa, 95 kDa
Observed Molecular Weight 135 kDa
GenBank Accession NumberBC109306
Gene Symbol CD22
Gene ID (NCBI) 933
RRIDAB_2881502
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP20273
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD22, also known as Siglec-2 (sialic acid binding Ig-like lectin 2) or BL-CAM (B-lymphocyte cell adhesion molecule), is a 130-140 kDa, B-cell restricted, type I transmembrane glycoprotein belonging to the immunoglobulin gene superfamily. The expression of CD22 is developmentally regulated. It is expressed at low levels in the cytoplasm of pro-B and pre-B cells and present on the cell surface only at mature stages of B-cell differentiation. Cell surface expression is lost during terminal differentiation into plasma cell and after B-cell activation. CD22 is an inhibitory receptor for B-cell receptor (BCR) signalling, preferentially binds to alpha-2,6-linked sialic acid and mediates B-cell B-cell interactions. It plays a crucial role in activation and differentiation of the B-cell.

Protocols

Product Specific Protocols
IF protocol for CD22 antibody 66103-1-IgDownload protocol
IHC protocol for CD22 antibody 66103-1-IgDownload protocol
WB protocol for CD22 antibody 66103-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanWB

Cell Death Discov

HSP90AA1 restrains clear cell renal cell carcinoma progression by promoting CADM1 expression and suppressing the PI3K-AKT pathway through interaction with FBXO7.

Authors - Wuping Yang
WB

Free Radic Biol Med

Extracellular vesicles released by ALL patients contain HNE-adducted proteins: Implications of collateral damage

Authors - Jenni Ho
humanIF

J Biomed Res

Causal genetic regulation of DNA replication on immune microenvironment in colorectal tumorigenesis: evidenced by an integrated approach of trans-omics and GWAS

Authors - Sumeng Wang

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Emma (Verified Customer) (11-29-2021)

Works well by IF on FFPE tissue. Antigen retrieval Tris-EDTA pH 9.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Prostate
CD22 Antibody Immunofluorescence validation (1:100 dilution) in Prostate (Cat no:66103-1-Ig)
Loading...
||
New chat

Able

正在加载,请稍候...