CoraLite®594-conjugated CD22 Monoclonal antibody

• 

  IF Staining of human tonsillitis using CL594-66103

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CL594-66103 (CD22 antibody) at dilution of 1:100.

• 

  IF Staining of human tonsillitis using CL594-66103

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CL594-66103 (CD22 antibody) at dilution of 1:100.

CD22 Monoclonal Antibody for IF-P

Cat No. CL594-66103

Clone No.7A2F1

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

IF-P

Synonyms

B cell receptor CD22, BL CAM, CD22, CD22 molecule, FLJ22814, SIGLEC 2, SIGLEC2, T cell surface antigen Leu 14

---

Tested Applications

• Positive IF-P detected in: human tonsillitis tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66103 targets CD22 in IF-P applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17986

  Product name: Recombinant human CD22 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 166-515 aa of BC109306

  Sequence: ILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPKKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETIGRR

• Full Name: CD22 molecule
• Calculated Molecular Weight: 847 aa, 95 kDa
• GenBank Accession Number: BC109306
• Gene Symbol: CD22
• Gene ID (NCBI): 933
• RRID: AB_2883513
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P20273
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

CD22, also known as Siglec-2 (sialic acid binding Ig-like lectin 2) or BL-CAM (B-lymphocyte cell adhesion molecule), is a 130-140 kDa, B-cell restricted, type I transmembrane glycoprotein belonging to the immunoglobulin gene superfamily. The expression of CD22 is developmentally regulated. It is expressed at low levels in the cytoplasm of pro-B and pre-B cells and present on the cell surface only at mature stages of B-cell differentiation. Cell surface expression is lost during terminal differentiation into plasma cell and after B-cell activation. CD22 is an inhibitory receptor for B-cell receptor (BCR) signalling, preferentially binds to alpha-2,6-linked sialic acid and mediates B-cell B-cell interactions. It plays a crucial role in activation and differentiation of the B-cell. And this antibody is conjugated with CL594, Ex/Em 593 nm/614 nm.