Tested Applications
| Positive WB detected in | HEK-293 cells, HepG2 cells, U2OS cells, A431 cells, HeLa cells, MCF-7 cells, K-562 cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human colon cancer tissue, human tonsillitis tissue, Ramos cells Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | U2OS cells |
| Positive FC (Intra) detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66172-1-Ig targets MSH6 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12645 Product name: Recombinant human MSH6 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-400 aa of BC004246 Sequence: MSRQSTLYSFFPKSPALSDANKASARASREGGRAAAAPGASPSPGGDAAWSEAGPGPRPLARSASPPKAKNLNGGLRRSVAPAAPTSCDFSPGDLVWAKMEGYPWWPCLVYNHPFDGTFIREKGKSVRVHVQFFDDSPTRGWVSKRLLKPYTGSKSKEAQKGGHFYSAKPEILRAMQRADEALNKDKIKRLELAVCDEPSEPEEEEEMEVGTTYVTDKSEEDNEIESEEEVQPKTQGSRRSSRQIKKRRVISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKRKRMVTGNGSLKRKSSRKETPSATKQATSISSETKNTLRAFSAPQNSESQAHVSGGGDDSSRPTVWYHETLEWLKEEKRRDEHRRRPDHPDFDASTLYVPE Predict reactive species |
| Full Name | mutS homolog 6 (E. coli) |
| Calculated Molecular Weight | 153 kDa |
| Observed Molecular Weight | 160 kDa |
| GenBank Accession Number | BC004246 |
| Gene Symbol | MSH6 |
| Gene ID (NCBI) | 2956 |
| RRID | AB_2881567 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P52701 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MSH6, also named as DNA mismatch repair protein Msh6 or GTMBP, is a 1360 amino acid protein, which contains one PWWP domain and belongs to the DNA mismatch repair MutS family. MSH6 localizes in the nucleus and is a component of the post-replicative DNA mismatch repair system. Msh2 and Msh6 form a protein complex required to repair mismatches generated during DNA replication.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for MSH6 antibody 66172-1-Ig | Download protocol |
| IF protocol for MSH6 antibody 66172-1-Ig | Download protocol |
| IHC protocol for MSH6 antibody 66172-1-Ig | Download protocol |
| IP protocol for MSH6 antibody 66172-1-Ig | Download protocol |
| WB protocol for MSH6 antibody 66172-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
MSH6 Monoclonal antibody (2E10B2), catalog number 66172-1-Ig, has 13 citations. These appear in journals including Cell Metabolism, Cancer Letters, EBioMedicine, Genome Biology, Cancer Immunology Research, Cell Reports, Journal of Medicinal Chemistry, Respiratory Research, Molecular Carcinogenesis, Surgery, Oncology Letters, Journal of Surgical Oncology, and Neuropathology. Research fields span DNA mismatch repair, gastric cancer, hepatocellular carcinoma, endometrial cancer, colorectal cancer, lung adenocarcinoma, pancreatic cancer, ovarian cancer, chemo-immunotherapy, and antiviral signaling.
| Species | Application | Title |
|---|---|---|
Cell Metab Nicotinamide metabolism face-off between macrophages and fibroblasts manipulates the microenvironment in gastric cancer | ||
Cancer Lett Inhibition of KIF20A enhances the immunotherapeutic effect of hepatocellular carcinoma by enhancing c-Myc ubiquitination | ||
EBioMedicine DNA methylation mediates the immunosuppressive tumour microenvironment in metastatic endometrial clear cell carcinoma. | ||
Genome Biol Multi-omics pleiotropic association analyses reveal functionally relevant genes and druggable pathways for ovarian aging. | ||
Cancer Immunol Res Remodeling Chondroitin-6-Sulfate-Mediated Immune Exclusion Enhances Anti-PD-1 Response in Colorectal Cancer with Microsatellite Stability. | ||
Cell Rep MSH6 regulates cGAS activity in antiviral and antitumor signaling pathways by governing its cytosolic/nuclear distribution.
|
