MSH6 Monoclonal antibody, PBS Only

• 

  WB analysis of HEK-293 using 66172-1-Ig (same clone as 66172-1-PBS)

  WB result of MSH6 antibody (66172-1-Ig, 1:1000) with si-Control and si-MSH6 transfected HEK293 cells. This data was developed using the same antibody clone with 66172-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 66172-1-Ig (same clone as 66172-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66172-1-Ig (MSH6 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66172-1-PBS in a different storage buffer formulation.

• 

  WB analysis of U2OS using 66172-1-Ig (same clone as 66172-1-PBS)

  U2OS cells were subjected to SDS PAGE followed by western blot with 66172-1-Ig (MSH6 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66172-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66172-1-Ig (same clone as 66172-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66172-1-Ig (MSH6 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66172-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 66172-1-Ig (same clone as 66172-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 66172-1-Ig (MSH6 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66172-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 66172-1-Ig (same clone as 66172-1-PBS)

  IP result of anti-MSH6 (IP:66172-1-Ig, 4ug; Detection:66172-1-Ig 1:600) with HEK-293 cells lysate 1800ug. This data was developed using the same antibody clone with 66172-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 66172-1-Ig (same clone as 66172-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66172-1-Ig (MSH6 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66172-1-PBS in a different storage buffer formulation.

• 

  IHC staining of Ramos using 66172-1-Ig (same clone as 66172-1-PBS)

  Immunohistochemical analysis of paraffin-embedded Ramos cells slide using 66172-1-Ig (MSH6 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66172-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 66172-1-Ig (same clone as 66172-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66172-1-Ig (MSH6 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66172-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 66172-1-Ig (same clone as 66172-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66172-1-Ig (MSH6 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66172-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 66172-1-Ig (same clone as 66172-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66172-1-Ig (MSH6 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66172-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 66172-1-Ig (same clone as 66172-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66172-1-Ig (MSH6 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66172-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 66172-1-Ig (same clone as 66172-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66172-1-Ig (MSH6 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66172-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 66172-1-Ig (same clone as 66172-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using MSH6 antibody (66172-1-Ig, Clone: 2E10B2 ) at dilution of 1:1000 and Multi-rAb CoraLite® Plus 594-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (Cat.NO. RGAM004 ). This data was developed using the same antibody clone with 66172-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HEK-293 using 66172-1-Ig (same clone as 66172-1-PBS)

  1x10^6 HEK-293 cells were intracellularly stained with 0.4 ug MSH6 Monoclonal antibody (66172-1-Ig, Clone:2E10B2) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1)(red), or 0.4 ug Mouse IgG2a isotype control Mouse McAb (66360-2-Ig, Clone: 11A1B2) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 66172-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

MSH6 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 66172-1-PBS

Clone No.2E10B2

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Synonyms

2E10B2, G/T mismatch binding protein, G/T mismatch-binding protein, GTBP, GTMBP

---

Product Information

66172-1-PBS targets MSH6 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12645

  Product name: Recombinant human MSH6 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-400 aa of BC004246

  Sequence: MSRQSTLYSFFPKSPALSDANKASARASREGGRAAAAPGASPSPGGDAAWSEAGPGPRPLARSASPPKAKNLNGGLRRSVAPAAPTSCDFSPGDLVWAKMEGYPWWPCLVYNHPFDGTFIREKGKSVRVHVQFFDDSPTRGWVSKRLLKPYTGSKSKEAQKGGHFYSAKPEILRAMQRADEALNKDKIKRLELAVCDEPSEPEEEEEMEVGTTYVTDKSEEDNEIESEEEVQPKTQGSRRSSRQIKKRRVISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKRKRMVTGNGSLKRKSSRKETPSATKQATSISSETKNTLRAFSAPQNSESQAHVSGGGDDSSRPTVWYHETLEWLKEEKRRDEHRRRPDHPDFDASTLYVPE

• Full Name: mutS homolog 6 (E. coli)
• Calculated Molecular Weight: 153 kDa
• Observed Molecular Weight: 160 kDa
• GenBank Accession Number: BC004246
• Gene Symbol: MSH6
• Gene ID (NCBI): 2956
• RRID: AB_2881567
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P52701
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MSH6, also named as DNA mismatch repair protein Msh6 or GTMBP, is a 1360 amino acid protein, which contains one PWWP domain and belongs to the DNA mismatch repair MutS family. MSH6 localizes in the nucleus and is a component of the post-replicative DNA mismatch repair system. Msh2 and Msh6 form a protein complex required to repair mismatches generated during DNA replication.