Tested Applications
| Positive WB detected in | A549 cells, LNCaP cells, HeLa cells, HEK-293 cells |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66331-1-Ig targets GP73/GOLPH2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, bovine |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7207 Product name: Recombinant human GOLM1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 36-400 aa of BC001740 Sequence: SRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL Predict reactive species |
| Full Name | golgi membrane protein 1 |
| Calculated Molecular Weight | 45 kDa |
| Observed Molecular Weight | 73 kDa |
| GenBank Accession Number | BC001740 |
| Gene Symbol | GP73 |
| Gene ID (NCBI) | 51280 |
| RRID | AB_2881712 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q8NBJ4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Golgi phosphoprotein 2 (GOLPH2, also known as GP73 or GOLM1) is a resident Golgi type-II membrane protein. It is predominantly expressed in the epithelial cells of many human tissues. GOLPH2 traffics through endosomes and can be secreted into the circulation. Its expression is upregulated in a number of tumors and GOLPH2 could be a promising serum marker for hepatocellular carcinoma. We got 73 kDa in western blotting due to phosphorylation.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for GP73/GOLPH2 antibody 66331-1-Ig | Download protocol |
| WB protocol for GP73/GOLPH2 antibody 66331-1-Ig | Download protocol |
| IF protocol for GP73/GOLPH2 antibody 66331-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The GP73/GOLPH2 Monoclonal antibody (Cat# 66331-1-Ig) has 9 citations published in journals including Molecular Cancer, Journal of Translational Medicine, Cell Reports, Microbiology Spectrum, Frontiers in Oncology, Histochemistry and Cell Biology, Veterinary Microbiology, and Cytotechnology. Research fields span oncology (colorectal and liver cancer, hepatocellular carcinoma), virology (bovine herpesvirus 1, SARS-CoV-2), autophagy, Golgi trafficking, and fibrosis.
| Species | Application | Title |
|---|---|---|
Mol Cancer GP73-dependent regulation of exosome biogenesis promotes colorectal cancer liver metastasis | ||
J Transl Med PTEN deficiency potentiates HBV-associated liver cancer development through augmented GP73/GOLM1 | ||
Cell Rep Cholesterol suppresses GOLM1-dependent selective autophagy of RTKs in hepatocellular carcinoma.
| ||
Microbiol Spectr Associating bovine herpesvirus 1 envelope glycoprotein gD with activated phospho-PLC-γ1(S1248) | ||
Microbiol Spectr Fatty acid synthase may facilitate the trafficking of bovine alpha herpesvirus 1 out of the Golgi apparatus, potentially promoting viral infection. | ||
Front Oncol TCF11 Has a Potent Tumor-Repressing Effect Than Its Prototypic Nrf1α by Definition of Both Similar Yet Different Regulatory Profiles, With a Striking Disparity From Nrf2. |
Reviews
What customers say
The single review reports using this antibody for an undergraduate cell biology lab where clear, easily observable structures were essential. The reviewer noted excellent, crisp Golgi staining, with every student successfully labeling their cells. The application was immunofluorescence on COS-7 cells at a 1:200 dilution, and the product received a 5-star rating. Overall, the feedback highlights reliable performance and consistent results suitable for teaching settings.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Nicholas (Verified Customer) (07-23-2025) | Used for an upper-level undergraduate cell biology laboratory course where easily observable structures and phenotypes is critical for student success. The antibody gave excellent clear Golgi staining - every student successfully labeled their cells.
|
