• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated GP73/GOLPH2 Monoclonal antibody

GP73/GOLPH2 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL594-66331
Clone No.3D1F1

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC, FC (Intra)

GOLM1, GOLPH2, GP73, 3D1F1, C9orf155

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells, HepG2 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66331 targets GP73/GOLPH2 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7207

Product name: Recombinant human GOLM1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 36-400 aa of BC001740

Sequence: SRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL

Predict reactive species
Full Name golgi membrane protein 1
Calculated Molecular Weight 45 kDa
GenBank Accession NumberBC001740
Gene Symbol GP73
Gene ID (NCBI) 51280
RRIDAB_2883560
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ8NBJ4
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Golgi phosphoprotein 2 (GOLPH2, also known as GP73 or GOLM1) is a resident Golgi type-II membrane protein. It is predominantly expressed in the epithelial cells of many human tissues. GOLPH2 traffics through endosomes and can be secreted into the circulation. Its expression is upregulated in a number of tumors and GOLPH2 could be a promising serum marker for hepatocellular carcinoma. We got 73 kDa in western blotting due to phosphorylation.

Protocols

Product Specific Protocols
FC protocol for CL594 GP73/GOLPH2 antibody CL594-66331Download protocol
IF protocol for CL594 GP73/GOLPH2 antibody CL594-66331Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...