CoraLite®594-conjugated GP73/GOLPH2 Monoclonal antibody

• 

  IF Staining of HeLa using CL594-66331

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite®594 GP73/GOLPH2 antibody (CL594-66331, Clone: 3D1F1 ) at dilution of 1:200.

• 

  IF Staining of HepG2 using CL594-66331

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CL594-66331 (GP73/GOLPH2 antibody) at dilution of 1:100.

• 

  FC experiment of HeLa using CL594-66331

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug CoraLite®594 Anti-Human GP73/GOLPH2 (CL594-66331, Clone:3D1F1) (red), or 0.4 ug Mouse IgG1 Isotype Control (CL594-66360, Clone: T1F8D3F10) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• Featured Product
• KD/KO Validated

GP73/GOLPH2 Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL594-66331

Clone No.3D1F1

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC, FC (Intra)

Synonyms

GOLM1, GOLPH2, GP73, 3D1F1, C9orf155

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells, HepG2 cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66331 targets GP73/GOLPH2 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7207

  Product name: Recombinant human GOLM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 36-400 aa of BC001740

  Sequence: SRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL

• Full Name: golgi membrane protein 1
• Calculated Molecular Weight: 45 kDa
• GenBank Accession Number: BC001740
• Gene Symbol: GP73
• Gene ID (NCBI): 51280
• RRID: AB_2883560
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q8NBJ4
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Golgi phosphoprotein 2 (GOLPH2, also known as GP73 or GOLM1) is a resident Golgi type-II membrane protein. It is predominantly expressed in the epithelial cells of many human tissues. GOLPH2 traffics through endosomes and can be secreted into the circulation. Its expression is upregulated in a number of tumors and GOLPH2 could be a promising serum marker for hepatocellular carcinoma. We got 73 kDa in western blotting due to phosphorylation.