• Featured Product
  • KD/KO Validated

GP73/GOLPH2 Monoclonal antibody, PBS Only (Detector)

GP73/GOLPH2 Monoclonal Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 66331-1-PBS
Clone No.3D1F1

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

GOLM1, GOLPH2, GP73, 3D1F1, C9orf155

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66331-1-PBS targets GP73/GOLPH2 as part of a matched antibody pair:

MP51312-3: 66331-2-PBS capture and 66331-1-PBS detection (validated in Cytometric bead array)

MP51312-4: 66331-3-PBS capture and 66331-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7207

Product name: Recombinant human GOLM1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 36-400 aa of BC001740

Sequence: SRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL

Predict reactive species
Full Name golgi membrane protein 1
Calculated Molecular Weight 45 kDa
Observed Molecular Weight 73 kDa
GenBank Accession NumberBC001740
Gene Symbol GP73
Gene ID (NCBI) 51280
RRIDAB_2881712
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ8NBJ4
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Golgi phosphoprotein 2 (GOLPH2, also known as GP73 or GOLM1) is a resident Golgi type-II membrane protein. It is predominantly expressed in the epithelial cells of many human tissues. GOLPH2 traffics through endosomes and can be secreted into the circulation. Its expression is upregulated in a number of tumors and GOLPH2 could be a promising serum marker for hepatocellular carcinoma. We got 73 kDa in western blotting due to phosphorylation.

Loading...
||
New chat Able
正在加载,请稍候...