• Featured Product
  • KD/KO Validated

MMP2 Monoclonal antibody, PBS Only (Detector)

MMP2 Monoclonal Antibody for WB, IHC, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 66366-1-PBS
Clone No.2B10D1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, FC (Intra), Cytometric bead array, Indirect ELISA

2B10D1, 72 kDa gelatinase, 72 kDa type IV collagenase, CLG4A, EC:3.4.24.24

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Published Applications

IHCSee 1 publications below

Product Information

66366-1-PBS targets MMP2 as part of a matched antibody pair:

MP51054-2: 66366-4-PBS capture and 66366-1-PBS detection (validated in Cytometric bead array)

MP51054-3: 66366-5-PBS capture and 66366-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag25039

Product name: Recombinant human MMP2 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 34-469 aa of BC002576

Sequence: IIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEIC

Predict reactive species
Full Name matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase)
Calculated Molecular Weight 72 kDa
Observed Molecular Weight 55-74 kDa
GenBank Accession NumberBC002576
Gene Symbol MMP2
Gene ID (NCBI) 4313
RRIDAB_2881746
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP08253
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

MMP2, also named as CLG4A, Gelatinase Am, TBE-1 and PEX, belongs to the peptidase M10A family. It is ubiquitinous metalloproteinase that is involved in diverse functions such as remodeling of the vasculature, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. MMP2 contributes to myocardial oxidative stress by regulating the activity of GSK3beta. It cleaves GSK3beta in vitro. MMP2 can be cleaved into PEX chain(~60kd).Western blot analysis showed that the 72 kDa and 62 kDa proteinase activities were pro-MMP2 and the active enzyme,respectively(PMID:11112697).

Publications

SpeciesApplicationTitle
humanIHC

Int J Mol Sci

Glial-Cell-Line-Derived Neurotrophic Factor Promotes Glioblastoma Cell Migration and Invasion via the SMAD2/3-SERPINE1-Signaling Axis

Authors - Xiaoxiao Guo
Loading...
||
New chat Able
正在加载,请稍候...