Tested Applications
| Positive WB detected in | rabbit brain tissue, PC-12 cells, fetal human brain tissue, rat brain tissue, mouse brain tissue, pig cerebellum tissue, rabbit cerebellum tissue, rat cerebellum tissue, mouse cerebellum tissue |
| Positive IHC detected in | rat cerebellum tissue, human kidney tissue, human small intestine tissue, human brain tissue, mouse kidney tissue, rat kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse cerebellum tissue, human kidney tissue, rat cerebellum tissue |
| Positive IF-Fro detected in | mouse cerebellum tissue, rat cerebellum tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:8000-1:32000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66394-1-Ig targets Calbindin-D28k in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.
| Tested Reactivity | human, mouse, rat, pig, rabbit |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5861 Product name: Recombinant human Calbindin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 110-261 aa of BC006478 Sequence: YDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN Predict reactive species |
| Full Name | calbindin 1, 28kDa |
| Calculated Molecular Weight | 30 kDa |
| Observed Molecular Weight | 28 kDa |
| GenBank Accession Number | BC006478 |
| Gene Symbol | Calbindin |
| Gene ID (NCBI) | 793 |
| RRID | AB_2881769 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P05937 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Calbindin-D28k is a member of the calcium-binding protein superfamily that includes calmodulin and troponin C. It is a cytosolic calcium binding protein highly expressed in the distal tubule, intestines, central nervous system, primary murine osteoblast cells and in several other organs. It plays an important role in the intracellular calcium homeostasis, its strong buffering capacity prevents cytotoxic effect of high concentration of free calcium in kidney, brain, pancreas, and intestine.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Calbindin-D28k antibody 66394-1-Ig | Download protocol |
| IHC protocol for Calbindin-D28k antibody 66394-1-Ig | Download protocol |
| WB protocol for Calbindin-D28k antibody 66394-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Calbindin-D28k Monoclonal antibody (catalog 66394-1-Ig) has 29 citations. They appear in journals including Nature Communications, Neuron, Advanced Science, Cell Death & Differentiation, Molecular Psychiatry, Free Radical Biology and Medicine, Cell Reports, PLoS Biology, JCI Insight, eLife, and others. Research fields span neuroscience (cerebellar/Purkinje cell function, memory, epilepsy, autism), renal disease (diabetic nephropathy, acute kidney injury), and neurodevelopmental disorders, using WB, IHC, and IF in human, mouse, and rat.
| Species | Application | Title |
|---|---|---|
Nat Commun Integrative transcriptome-wide association analyses reveal PRKCG-linked GABAergic dysfunction in Fragile X-associated tremor/ataxia syndrome. | ||
Adv Sci (Weinh) Pathogenicity of Mediator Complex Subunit 27 (MED27) in a Neurodevelopmental Disorder with Cerebellar Atrophy | ||
Adv Sci (Weinh) Integrative Single-Cell Transcriptomics and Epigenomics Mapping of the Fetal Retina Developmental Dynamics | ||
Cell Death Differ The long noncoding RNA Synage regulates synapse stability and neuronal function in the cerebellum. | ||
Mol Psychiatry Cerebellar microglia-derived IL-17A mitigates autism-related behavioral and synaptic deficits. |
Reviews
What customers say
The single review for this antibody rates it 5 stars. The user performed immunofluorescence on human brain cortex FFPE tissue at a 1:100 dilution and reported excellent results, noting that the Calbindin signal (green) clearly marked neurons (red). Overall, the feedback is strongly positive, highlighting reliable staining and clear neuronal labeling in brain tissue.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Reyes (Verified Customer) (08-08-2024) | Calbindin (green) worked perfectly marking some of my neurons (red) in human brain ffpe tissue
 |
