Calbindin-D28k Monoclonal antibody, PBS Only

• 

  WB analysis using 66394-1-Ig (same clone as 66394-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66394-1-Ig (Calbindin-D28k antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66394-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-12 using 66394-1-Ig (same clone as 66394-1-PBS)

  PC-12 cells were subjected to SDS PAGE followed by western blot with 66394-1-Ig (Calbindin-D28k antibody at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66394-1-PBS in a different storage buffer formulation.

• 

  WB analysis of fetal human brain using 66394-1-Ig (same clone as 66394-1-PBS)

  Human brain, rat brain and mouse brain tissues were subjected to SDS PAGE followed by western blot with 66394-1-Ig (Calbindin-D28k antibody at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66394-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat cerebellum using 66394-1-Ig (same clone as 66394-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue slide using 66394-1-Ig (Calbindin-D28k antibody) at dilution of 1:16000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66394-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 66394-1-Ig (same clone as 66394-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 66394-1-Ig (Calbindin-D28k antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66394-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat cerebellum using 66394-1-Ig (same clone as 66394-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue slide using 66394-1-Ig (Calbindin-D28k antibody) at dilution of 1:16000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66394-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 66394-1-Ig (same clone as 66394-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 66394-1-Ig (Calbindin-D28k antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66394-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat kidney using 66394-1-Ig (same clone as 66394-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 66394-1-Ig (Calbindin-D28k antibody) at dilution of 1:32000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66394-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat kidney using 66394-1-Ig (same clone as 66394-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 66394-1-Ig (Calbindin-D28k antibody) at dilution of 1:32000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66394-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 66394-1-Ig (same clone as 66394-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 66394-1-Ig (Calbindin-D28k antibody) at dilution of 1:32000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66394-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 66394-1-Ig (same clone as 66394-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 66394-1-Ig (Calbindin-D28k antibody) at dilution of 1:32000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66394-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 66394-1-Ig (same clone as 66394-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 66394-1-Ig (Calbindin-D28k antibody at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 66394-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 66394-1-Ig (same clone as 66394-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 66394-1-Ig (Calbindin-D28k antibody at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 66394-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 66394-1-Ig (same clone as 66394-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 66394-1-Ig (Calbindin-D28k antibody at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 66394-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 66394-1-Ig (same clone as 66394-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 66394-1-Ig (Calbindin-D28k antibody at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 66394-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse cerebellum using 66394-1-Ig (same clone as 66394-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse cerebellum tissue using Calbindin-D28k antibody (66394-1-Ig, Clone: 1F8B9 ) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66394-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human kidney using 66394-1-Ig (same clone as 66394-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human kidney tissue using Calbindin-D28k antibody (66394-1-Ig, Clone: 1F8B9 ) at dilution of 1:300 and CoraLite®594-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), Podocalyxin antibody(18150-1-AP, green). This data was developed using the same antibody clone with 66394-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat cerebellum using 66394-1-Ig (same clone as 66394-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat cerebellum tissue using Calbindin-D28k antibody (66394-1-Ig, Clone: 1F8B9 ) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66394-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse cerebellum using 66394-1-Ig (same clone as 66394-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse cerebellum tissue using Calbindin-D28k antibody (66394-1-Ig, Clone: 1F8B9 ) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66394-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat cerebellum using 66394-1-Ig (same clone as 66394-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat cerebellum tissue using Calbindin-D28k antibody (66394-1-Ig, Clone: 1F8B9 ) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66394-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat cerebellum using 66394-1-Ig (same clone as 66394-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed frozen OCT-embedded rat cerebellum tissue using Calbindin-D28k antibody (66394-1-Ig, Clone: 1F8B9 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1), TDP-43 antibody (10782-2-AP, red). This data was developed using the same antibody clone with 66394-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse cerebellum using 66394-1-Ig (same clone as 66394-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed frozen OCT-embedded mouse cerebellum tissue using Calbindin-D28k antibody (66394-1-Ig, Clone: 1F8B9 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1), TDP-43 antibody (10782-2-AP, red). This data was developed using the same antibody clone with 66394-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-12 using 66394-1-Ig (same clone as 66394-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed PC-12 cells using 66394-1-Ig (Calbindin-D28k antibody) at dilution of 1:100 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66394-1-PBS in a different storage buffer formulation.

Calbindin-D28k Monoclonal Antibody for WB, IHC, IF-P, IF-Fro, ELISA

Cat No. 66394-1-PBS

Clone No.1F8B9

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF-P, IF-Fro, ELISA

Synonyms

CALB1, Calbindin, 1F8B9, CALB, calbindin 1, 28kDa

---

Product Information

66394-1-PBS targets Calbindin-D28k in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

• Tested Reactivity: human, mouse, rat, pig, rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5861

  Product name: Recombinant human Calbindin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 109-261 aa of BC006478

  Sequence: KYDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN

• Full Name: calbindin 1, 28kDa
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC006478
• Gene Symbol: Calbindin
• Gene ID (NCBI): 793
• RRID: AB_2881769
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P05937
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Calbindin-D28k is a member of the calcium-binding protein superfamily that includes calmodulin and troponin C. It is a cytosolic calcium binding protein highly expressed in the distal tubule, intestines, central nervous system, primary murine osteoblast cells and in several other organs. It plays an important role in the intracellular calcium homeostasis, its strong buffering capacity prevents cytotoxic effect of high concentration of free calcium in kidney, brain, pancreas, and intestine.