Tested Applications
| Positive WB detected in | T-47D cells, HEK-293 cells, MCF-7 cells, pig skin tissue, rat skin tissue |
| Positive IHC detected in | human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human skin cancer tissue |
| Positive IF/ICC detected in | MCF-7 cells |
| Positive FC (Intra) detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2500-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66468-1-Ig targets CRABP2 in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0309 Product name: Recombinant human CRABP2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-138 aa of BC001109 Sequence: MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE Predict reactive species |
| Full Name | cellular retinoic acid binding protein 2 |
| Calculated Molecular Weight | 16 kDa |
| Observed Molecular Weight | 14 kDa |
| GenBank Accession Number | BC001109 |
| Gene Symbol | CRABP2 |
| Gene ID (NCBI) | 1382 |
| RRID | AB_2881836 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P29373 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cellular retinoic acid binding protein 2 (CRABP2, synonyms: RBP6, CRABP-II). A number of specific carrier proteins for members of the vitamin A family have been discovered. Cellular retinoic acid binding proteins (CRABP) are low molecular weight proteins whose precise function remains unknown. CRABP2 is important in retinoic acid-mediated regulation of human skin growth and differentiation. It has been postulated that the CRABP2 gene is transcriptionally regulated by a newly synthesized regulatory protein.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CRABP2 antibody 66468-1-Ig | Download protocol |
| IF protocol for CRABP2 antibody 66468-1-Ig | Download protocol |
| IHC protocol for CRABP2 antibody 66468-1-Ig | Download protocol |
| WB protocol for CRABP2 antibody 66468-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-CRABP2 antibody (Cat# 66468-1-Ig) has 4 citations. These appear in Cell Death & Disease, npj Precision Oncology, Cell Signaling, and PLoS ONE. The research spans cancer biology—gastric cancer oxaliplatin resistance, anaplastic thyroid cancer drug sensitivity, and colorectal cancer peritoneal metastasis via EMT—as well as ocular research on limbal stromal cell migration. Applications include WB, IHC, and IF in human and mouse samples.
| Species | Application | Title |
|---|---|---|
Cell Death Dis Upregulation of CRABP2 by TET1-mediated DNA hydroxymethylation attenuates mitochondrial apoptosis and promotes oxaliplatin resistance in gastric cancer | ||
NPJ Precis Oncol ZEB1 and ALKBH5 coregulate CRABP2 and FABP5 and jointly determine the sensitivity of anaplastic thyroid cancers to gemcitabine and retinoic acid. | ||
Cell Signal CRABP2 promotes peritoneal metastasis in CRC through TGF-β/Smad-mediated EMT signaling and invadopodia formation | ||
PLoS One Increased sensitivity of primary aniridia limbal stromal cells to travoprost, leading to elevated migration and MMP-9 protein levels, in vitro |
Reviews
What customers say
The single review reports using this antibody for Western Blot at a 1:1000 dilution on porcine chondrocyte lysate, with a 4-star rating. The user confirmed it worked well for their application, providing a representative blot image. Overall, the feedback is positive, indicating reliable performance in detecting the target protein in pig chondrocytes under standard WB conditions.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Linyi (Verified Customer) (01-17-2019) | We use this antibody on porcine chondrocytes lysate, 1/1000 dilution.
 |
