CRABP2 Monoclonal antibody, PBS Only

• 

  WB analysis of T-47D using 66468-1-Ig (same clone as 66468-1-PBS)

  T-47D cells were subjected to SDS PAGE followed by western blot with 66468-1-Ig (CRABP2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66468-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 66468-1-Ig (same clone as 66468-1-PBS)

  WB result of CRABP2 antibody (66468-1-Ig; 1:500; incubated at room temperature for 1.5 hours) with sh-Control and sh-CRABP2 transfected HEK-293 cells. This data was developed using the same antibody clone with 66468-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 66468-1-Ig (same clone as 66468-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 66468-1-Ig (CRABP2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66468-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat skin using 66468-1-Ig (same clone as 66468-1-PBS)

  rat skin tissue were subjected to SDS PAGE followed by western blot with 66468-1-Ig (CRABP2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66468-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig skin using 66468-1-Ig (same clone as 66468-1-PBS)

  pig skin tissue were subjected to SDS PAGE followed by western blot with 66468-1-Ig (CRABP2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66468-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 66468-1-Ig (same clone as 66468-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 66468-1-Ig (CRABP2 antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66468-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 66468-1-Ig (same clone as 66468-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 66468-1-Ig (CRABP2 antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66468-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human skin cancer using 66468-1-Ig (same clone as 66468-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human skin cancer tissue using CRABP2 antibody (66468-1-Ig, Clone: 1A5F3 ) at dilution of 1:100 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66468-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 66468-1-Ig (same clone as 66468-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using CRABP2 antibody (66468-1-Ig, Clone: 1A5F3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 66468-1-PBS in a different storage buffer formulation.

• 

  FC experiment of MCF-7 using 66468-1-Ig (same clone as 66468-1-PBS)

  1X10^6 MCF-7 cells were intracellularly stained with 0.4 ug Anti-Human CRABP2 (66468-1-Ig, Clone:1A5F3) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG1 Isotype Control (MOPC-21) (65124-1-Ig, Clone: MOPC-21) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 66468-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CRABP2 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA

Cat No. 66468-1-PBS

Clone No.1A5F3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA

Synonyms

1A5F3, Cellular retinoic acid binding protein II, Cellular retinoic acid-binding protein 2, Cellular retinoic acid-binding protein II, CRABP II

---

Product Information

66468-1-PBS targets CRABP2 in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0309

  Product name: Recombinant human CRABP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-138 aa of BC001109

  Sequence: MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE

• Full Name: cellular retinoic acid binding protein 2
• Calculated Molecular Weight: 16 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC001109
• Gene Symbol: CRABP2
• Gene ID (NCBI): 1382
• RRID: AB_2881836
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P29373
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cellular retinoic acid binding protein 2 (CRABP2, synonyms: RBP6, CRABP-II). A number of specific carrier proteins for members of the vitamin A family have been discovered. Cellular retinoic acid binding proteins (CRABP) are low molecular weight proteins whose precise function remains unknown. CRABP2 is important in retinoic acid-mediated regulation of human skin growth and differentiation. It has been postulated that the CRABP2 gene is transcriptionally regulated by a newly synthesized regulatory protein.