Tested Applications
| Positive WB detected in | HepG2 cells, HEK-293 cells, HeLa cells, Jurkat cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:20000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66591-1-Ig targets FASN in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, monkey, bovine |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0975 Product name: Recombinant human FASN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 142-439 aa of BC007909 Sequence: QTQLNLRSLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSLAEPRVSVREG Predict reactive species |
| Full Name | fatty acid synthase |
| Calculated Molecular Weight | 272 kDa |
| Observed Molecular Weight | 272 kDa |
| GenBank Accession Number | BC007909 |
| Gene Symbol | FASN |
| Gene ID (NCBI) | 2194 |
| RRID | AB_2881951 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P49327 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FASN gene codes for an enzyme essential for de novo fatty acid synthesis and cellular substrate energy metabolism. Active FASN is a homodimer in which each peptide subunit has a molecular weight of 260 kDa. FASN is overexpressed in various types of cancer including glioblastomas and is a potential therapeutic target. Recently FASN has been reported to contribute to the neurogenesis since FASN mutation caused intellectual disability in mice.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for FASN antibody 66591-1-Ig | Download protocol |
| IHC protocol for FASN antibody 66591-1-Ig | Download protocol |
| IP protocol for FASN antibody 66591-1-Ig | Download protocol |
| WB protocol for FASN antibody 66591-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The FASN Monoclonal antibody (catalog number 66591-1-Ig) has 45 citations. These appear in journals including Nature, Molecular Cancer, Journal of Hepatology, Cell Discovery, Theranostics, Cell Death & Disease, International Journal of Biological Sciences, Journal of Translational Medicine, Cell Reports, mBio, Journal of Lipid Research, iScience, and Advanced Science. Research fields span lipid metabolism, fatty acid synthesis, cholesterol biosynthesis, non-alcoholic fatty liver disease/MASLD, and multiple cancers (liver, breast, lung, colon, gastric, prostate, cervical, and glioblastoma), with applications mainly in WB, IHC, IF, and IP.
| Species | Application | Title |
|---|---|---|
Mol Cancer ZDHHC20 mediated S-palmitoylation of fatty acid synthase (FASN) promotes hepatocarcinogenesis | ||
J Hepatol OGDHL silencing promotes hepatocellular carcinoma by reprogramming glutamine metabolism. | ||
Theranostics Herb-sourced emodin inhibits angiogenesis of breast cancer by targeting VEGFA transcription. |
Reviews
What customers say
The single review for this product reports a 4-star rating from a Western Blot experiment. The user detected a band in the 200–300 kDa region in HEK293T cells using a 1:2000 dilution. Overall, the feedback is positive, confirming the antibody's ability to produce a detectable signal in the expected molecular weight range under standard WB conditions.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Sun (Verified Customer) (01-05-2023) | We detected a band around 200-300kDa region in HEK293T cells using this antibody.
|
