PLZF Monoclonal antibody, PBS Only (Detector)

PLZF Monoclonal Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 66672-1-PBS
Clone No.2E6F12

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

WB, Cytometric bead array, Indirect ELISA

ZBTB16, 2E6F12, Zinc finger and BTB domain-containing protein 16, Zinc finger protein 145, Zinc finger protein PLZF

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66672-1-PBS targets PLZF as part of a matched antibody pair:

MP50366-1: 66672-2-PBS capture and 66672-1-PBS detection (validated in Cytometric bead array)

MP50366-2: 66672-3-PBS capture and 66672-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag25180

Product name: Recombinant human PLZF protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 101-400 aa of BC026902

Sequence: DLLYAAEILEIEYLEEQCLKMLETIQASDDNDTEATMADGGAEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPMVDQSPSVSTSFGLSAMSPTKAAVDSLMTIGQSLLQGTLQPPAGPEEPTLAGGGRHPGVAEVKTEMMQVDEVPSQDSPGAAESSISGGMGDKVEERGKEGPGTPTRSSVITSARELHYGREESAEQVPPPAEAGQAPTGRPEHPAPPPEKHLGIYSVLPNHKADAVLSMPSSVTSGLHVQPALAVSMDFSTYGGLLPQGFIQRELFSKLGELAVGMKSESR

Predict reactive species
Full Name zinc finger and BTB domain containing 16
Calculated Molecular Weight 673 aa, 74 kDa
Observed Molecular Weight 75 kDa
GenBank Accession NumberBC026902
Gene Symbol PLZF
Gene ID (NCBI) 7704
RRIDAB_2882026
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ05516
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PLZF, also named as Zinc finger protein 145, is a 673 amino acid protein, which belongs to the krueppel C2H2-type zinc-finger protein family. PLZF is expressed in bone marrow, early myeloid cell lines and peripheral blood mononuclear cells. PLZF may play a role in myeloid maturation and in the development and/or maintenance of other differentiated tissues.

Loading...
||
New chat Able
正在加载,请稍候...