Tested Applications
| Positive WB detected in | HSC-T6 cells, HeLa cells, HEK-293 cells, HepG2 cells, NIH/3T3 cells, Neuro-2a cells |
| Positive IF-P detected in | mouse kidney tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66772-1-Ig targets SSTR5 in WB, IHC, IF-P, CoIP, ELISA applications and shows reactivity with Human, Mouse, Rat samples.
| Tested Reactivity | Human, Mouse, Rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18615 Product name: Recombinant human SSTR5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 302-364 aa of BC146576 Sequence: VLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQTSKL Predict reactive species |
| Full Name | somatostatin receptor 5 |
| Calculated Molecular Weight | 364 aa, 39 kDa |
| Observed Molecular Weight | 41 kDa |
| GenBank Accession Number | BC146576 |
| Gene Symbol | SSTR5 |
| Gene ID (NCBI) | 6755 |
| RRID | AB_2882118 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P35346 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Somatostatin is a widely distributed peptide with a broad range of biological actions. Two biological forms of somatostatin exist: somatostatin-14 and -28. Somatostatin receptors (SSTR1, 2A and B, 3, 4 and 5) belong to the G protein coupled receptor family and have a wide expression pattern in both normal tissues and solid tumors (PMID: 23872332). SSTR5 has greater affinity for somatostatin-28 than somatostatin-14 (PMID: 8373420).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SSTR5 antibody 66772-1-Ig | Download protocol |
| WB protocol for SSTR5 antibody 66772-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
SSTR5 Monoclonal antibody (2B10D8), catalog number 66772-1-Ig, has 6 total citations. These appear in Phytomedicine, Cell Death Discovery, EMBO Journal, Frontiers in Endocrinology, FASEB Journal, and Endocrine Journal. The research fields span somatostatin receptor signaling, GPCR dimerization, pancreatic cancer, pancreatic β-cell function, corticotroph adenomas, and traditional medicine mechanisms.
| Species | Application | Title |
|---|---|---|
Phytomedicine Differential effect of polysaccharide and nonpolysaccharide components in Sijunzi decoction on spleen deficiency syndrome and their mechanisms. | ||
Cell Death Discov Repositioning Lomitapide to block ZDHHC5-dependant palmitoylation on SSTR5 leads to anti-proliferation effect in preclinical pancreatic cancer models | ||
EMBO J Somatostatin triggers local cAMP and Ca2+ signaling in primary cilia to modulate pancreatic β-cell function | ||
Front Endocrinol (Lausanne) Dimerization of GPCRs: Novel insight into the role of FLNA and SSAs regulating SST2 and SST5 homo- and hetero-dimer formation | ||
FASEB J Structural and Functional Basis of SSTR5 Homodimerization in Controlling Receptor Signaling and Pasireotide Response in Corticotroph Adenomas. | ||
Endocr J Differential effects of β-arrestin1 and β-arrestin2 on somatostatin receptors in murine AtT-20 corticotroph tumor cells. |
