CoraLite® Plus 488-conjugated SSTR5 Monoclonal antibody

SSTR5 Monoclonal Antibody for IF-P
Cat No. CL488-66772
Clone No.2B10D8

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat

Applications

IF-P

somatostatin receptor 5, Somatostatin receptor type 5, SS 5 R, SS5 R, SS5R, SSTR5

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse kidney tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66772 targets SSTR5 in IF-P applications and shows reactivity with Human, Mouse, Rat samples.

Tested Reactivity Human, Mouse, Rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag18615

Product name: Recombinant human SSTR5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 302-364 aa of BC146576

Sequence: VLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQTSKL

Predict reactive species
Full Name somatostatin receptor 5
Calculated Molecular Weight 364 aa, 39 kDa
Observed Molecular Weight 41 kDa
GenBank Accession NumberBC146576
Gene Symbol SSTR5
Gene ID (NCBI) 6755
RRIDAB_2934495
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP35346
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Somatostatin is a widely distributed peptide with a broad range of biological actions. Two biological forms of somatostatin exist: somatostatin-14 and -28. Somatostatin receptors (SSTR1, 2A and B, 3, 4 and 5) belong to the G protein coupled receptor family and have a wide expression pattern in both normal tissues and solid tumors (PMID: 23872332). SSTR5 has greater affinity for somatostatin-28 than somatostatin-14 (PMID: 8373420).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 SSTR5 antibody CL488-66772Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...