• Featured Product
  • KD/KO Validated

SOX10 Monoclonal antibody, PBS Only (Capture)

SOX10 Monoclonal Antibody for WB, IHC, IF-P, IF-Fro, FC (Intra), Cytometric bead array, Indirect ELISA

Cat No. 66786-1-PBS
Clone No.1D2C8

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IF-Fro, FC (Intra), Cytometric bead array, Indirect ELISA

1D2C8, DOM, PCWH, SRY-box transcription factor 9, Transcription factor SOX 10

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66786-1-PBS targets SOX10 as part of a matched antibody pair:

MP50275-1: 66786-1-PBS capture and 66786-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag23191

Product name: Recombinant human SOX10 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 267-466 aa of BC002824

Sequence: GKPHIDFGNVDIGEISHEVMSNMETFDVAELDQYLPPNGHPGHVSSYSAAGYGLGSALAVASGHSAWISKPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQRPLYTAISDPSPSGPQSHSPTHWEQPVYTTLSRP

Predict reactive species
Full Name SRY (sex determining region Y)-box 10
Calculated Molecular Weight 50 kDa
Observed Molecular Weight 55-60 kDa
GenBank Accession NumberBC002824
Gene Symbol SOX10
Gene ID (NCBI) 6663
RRIDAB_2882131
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP56693
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Sox10 is a transcription factor that has a crucial role in complex signalling pathways regulating central nervous system and neural crest development. The calcualted molecular weight of SOX10 is 50 kDa, but modified SOX10 is about 55-60 kDa. (PMID: 23799842)

Loading...
||
New chat Able
正在加载,请稍候...